Dataset for protein BCL-2-like of organism Accipiter nisus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B9RZD1_BCL2A1-      ----------METAEFYYVYY-----------------------------
A0A8B9M984_MCL1-02      ------MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVP
A0A8B9M984_MCL1-01      ------MFAVKRNAVIGFNLYCGGGPALAPASPGGGPAPPPPPAAAAEVP
A0A8B9N2I0_BCL2L1-      ------MSSSNRELVIDFVSY-----------------------------
A0A8B9RWH9_BCL2-01      MAHPGRRGYDNREIVLKYIHY-----------------------------
                                       : :  *                             

A0A8B9RZD1_BCL2A1-      -------------------------------------------LAQDYLQ
A0A8B9M984_MCL1-02      GTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPAARPGALWSPEEELD
A0A8B9M984_MCL1-01      GTLIGSVAAWAAAGRPEHPRALVGCGAAPRAALPPAARPGALWSPEEELD
A0A8B9N2I0_BCL2L1-      -KLSQKGYSWSQLEEEDENRTDFAAEEAEMDGVLNG--------------
A0A8B9RWH9_BCL2-01      -KLSQRGYDWAAAEDRAPLPPGLSPPAAAAAAVAAAAAAAAAAGTSSDHT
                                                                          

A0A8B9RZD1_BCL2A1-      YVLQESHLGPAQTRVAH---------------------------------
A0A8B9M984_MCL1-02      GCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEP
A0A8B9M984_MCL1-01      GCEPEAERGPAGDSLPGTPPGPPEPPDGLRQDSLELISRYLREAAGEAEP
A0A8B9N2I0_BCL2L1-      ---SPSWHPPASHVVNGAAMHRSSLE------------------------
A0A8B9RWH9_BCL2-01      GLVSPHPEPPGSAAASHAPPAEGLPP------------------------
                                 *.                                       

A0A8B9RZD1_BCL2A1-      -----------------------------VLRNIASSLQDQTEEALRPFL
A0A8B9M984_MCL1-02      AVKKLFPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGML
A0A8B9M984_MCL1-01      AVKKLFPGLLGGPGRPGGSGDAVMEKALETLRRVGDGVMQKHELAFQGML
A0A8B9N2I0_BCL2L1-      -----------------VHEIVQTADVRQALREAGDEFELRYRRAFSDLT
A0A8B9RWH9_BCL2-01      -----------------APQVVHL-----ALRQAGDEFSRRYQRDFAQMS
                                                     .**  .. .  .    :  : 

A0A8B9RZD1_BCL2A1-      DRIDITSVAVAKRIFNGVMEEKFADGNTNWGRIMTIFTFGGLLTKKLQEH
A0A8B9M984_MCL1-02      RKLEIQKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSI
A0A8B9M984_MCL1-01      RKLEIQKEEDLQS-VCEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSI
A0A8B9N2I0_BCL2L1-      SQLHITPGTAYQS-FEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDK
A0A8B9RWH9_BCL2-01      GQLHLTPFTARGR-FVAVVEELFRDGV-NWGRIVAFFEFGGVMCVESVNR
                         .: :         .  *    * **  ****::::: **. :     . 

A0A8B9RZD1_BCL2A1-      GVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFE-------
A0A8B9M984_MCL1-02      NQERC---ISSLAGIITDALVSSKREWLMSQGGWE-GFVDFFRVEDLEGS
A0A8B9M984_MCL1-01      NQERC---ISSLAGIITDALVSSKREWLMSQGGWE-GFVDFFRVEDLEGS
A0A8B9N2I0_BCL2L1-      EMRVL---VGRVVSWMTTYLTDHLDPWIQENGGWE-RFVDLYG-NDAAAE
A0A8B9RWH9_BCL2-01      EMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWD-AFVELYG-NSM---
                                   :   :*  :      *:  :***:  *:  :        

A0A8B9RZD1_BCL2A1-      -RRSLLSFS----------------KITAMFIAVFSLLREYY--------
A0A8B9M984_MCL1-02      IRNVLMAFA----------------GVAGLGASLAYMIR-----------
A0A8B9M984_MCL1-01      IRNVLMAFA----------------GVAGLGASLAYMIRNVTNCWIPSLG
A0A8B9N2I0_BCL2L1-      VRKGQETFN------KWLLTGATVAGVLLLGSLLSRK-------------
A0A8B9RWH9_BCL2-01      ----RPLFDFSWISLKTILSLVLVGACITLGAYLGHK-------------
                               *                     :   :                

A0A8B9RZD1_BCL2A1-      --------------------------------------------------
A0A8B9M984_MCL1-02      --------------------------------------------------
A0A8B9M984_MCL1-01      WQGTEFCSSWDGSCPRPALLLSMPGTLQETWQAHPRSAHSFFLSSSQLKP
A0A8B9N2I0_BCL2L1-      --------------------------------------------------
A0A8B9RWH9_BCL2-01      --------------------------------------------------
                                                                          

A0A8B9RZD1_BCL2A1-      --------------------------------------------------
A0A8B9M984_MCL1-02      --LQVPMRIYCFGKRKWKN-------------------------------
A0A8B9M984_MCL1-01      LSLLVSLCLQSYGDSPWGPEQFLLNKATGLGVPSSSSKSCCDSAVLPCAA
A0A8B9N2I0_BCL2L1-      --------------------------------------------------
A0A8B9RWH9_BCL2-01      --------------------------------------------------
                                                                          

A0A8B9RZD1_BCL2A1-      --------------------------------------------------
A0A8B9M984_MCL1-02      --------------------------------------------------
A0A8B9M984_MCL1-01      WLKRCPAALGTRCKPCHPSERLDSLPKSHQCPRNPSEHWGSALFPPSRVH
A0A8B9N2I0_BCL2L1-      --------------------------------------------------
A0A8B9RWH9_BCL2-01      --------------------------------------------------
                                                                          

A0A8B9RZD1_BCL2A1-      ----
A0A8B9M984_MCL1-02      ----
A0A8B9M984_MCL1-01      AQGW
A0A8B9N2I0_BCL2L1-      ----
A0A8B9RWH9_BCL2-01      ----
                            

© 1998-2022Legal notice