Dataset for protein Noxa of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------mpgkkar-knaqpsparapaele----vecatql-----
mrssgslgsrirgllesagweelvrsqprahqgltsgrcgq---rr--srs-p-nttavqlgp-qrdvgtagiardqagf
                                        mwrv--lk --kklpasvte-d-a  a --eqlrksgccl
                                         tltsttg mar-eg-pp--g-qp    talsqeit   r
                                          kslvs  spqsa-smlqrvpav    fs  fg      
                                          grgsq  qmggvq egpaqqtq    aq  -       
                                           qeli  ggf sk     pnvk    ep  r       
                                           p ec  e   qa     eard    dl  p       
                                           c                  i     ii  m       
                                                                    c           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
gigmqlahftrgkkllstwsssditaplalprgheeqvqvarsrvcystqeiwrqtelpaetsesdsqtlllrnltaskt
ssslp  rycitdpvvccylqplsswvgvrmp kssrssatgrspsfa      parvrgdlkdeciaqnpt valppdp
 re       psatryasscatealvq  qva lkakkftmkfill          km trrfrrnth         t  
          v    a lg t   ie   e     q arm   e d           a   vev  vd            
               s e  e                                             a             
               n                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
          .          .  :                            
--------Rrfgdklnfrqkllnlisklfcsgt--------------------
ciecaiqfggiqkriflqrctfhqfaerlrcnwkiqtggkrgalgngrwntsk
em       kllqlvdwkyrivevle---hlvqeekmeafm            
 v       tv tisy l  vmyfmtanynpl- aced               
         q    as       m y  i-tkn                    
         n    qh       k v   sai                     
              f        i l   g                       
              c          i   e                       
                         c                           
                                                     
© 1998-2020Legal notice