Dataset for protein Noxa of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------------mpgkkar-kna
mrssgslgsrirgllesagweelvrsqprahqgltsgrcgqtrreelrgsfgpppaagagrsptseafg-ssrrlssrsl
                                                     eesvvscnrseprvlrr---tsk s--
                                                        raragq dl gamlgll-fv -pr
                                                            fa      kqrvcs-g trg
                                                                     ylttev- etc
                                                                     wkpsciq pgs
                                                                     vacqlem laq
                                                                     s ahdtl  qk
                                                                     i  garh  mf
                                                                     a  avqe  l 
                                                                         npd  i 
                                                                         hh     
                                                                          c     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qpsp-arapael------------------------------------------------------e----vecAiq---
p-a-pt-pqpgpaaagtagtardqagfgigmqlrftrpkfrlllaempgkkllssstsssplalprgheeqaqvstsrvc
-l-ra-a-t-dartcylrsqgarvrslssrspghyaa tstrvf q a rrsr rnlqpn trvalprdavi-i-lects
sana spv-rp-gptspqrftptltkwktefyftlsq gilvp       sav kvaftw avasgvatpedmspr- a 
ksgt mltvq-rdllqsppv kvts rartv clwrh eg e        etk tmse d is   kqrlrrkf gr   
gqts fcsrnstceelcnfp gqdq k qkt  g qf da           qf   r         -plvk-   -p   
ewre wvqaekq   d lea dncn i dan  f                 f    f         qk d t   m    
avq  vslmsvv      a         c                                     sd   s   q    
 np  rngemrk                                                      r    m   s    
  l  pgellqs                                                      a    e   k    
  i  n ckgfi                                                               c    
     k  gcae                                                               a    
        d  c                                                                    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                      .          .                              
-----------------------------------lRrigdklnfrqkllnliskl-----fcsgt--------------
ystqeiwrqtelpaetsesdsqtlllrnltasktcmtgfqqrwflqrctfhqfaerrtrlglrpnwegkrghmmrnlgnp
larrkavgeck e   f   i          tn  i kllklsdwkyrivevlean     qhcv-develcgegag gg
f e d  a  a                        f vm tiisrldlvmymstti     inlkpwvpacaf       
                                   k tv gqah h  s gkmyrf     yktenprc           
                                     q    vy      ai vda     esiqrkia           
                                     n    c          p        gflmga            
                                     i    f          l        fahk              
                                     a               i        e                 
                                                     c                          
                                                                                
                                                                                
                                                                                
                                                                                

       250     
....:....|....:
               
---------------
wwntskrrgstdtgr
rlcgfg         
               
               
               
               
               
               
               
               
               
               
               
© 1998-2022Legal notice