Dataset for protein Noxa of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

75 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGS
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
Q5U777_PMAIP1-01        --------------------------------------------------
A0A4X1TQ35_PMAIP1-      ----------------------------------------------TSEA
F1SMU1_PMAIP1-01        --------------------------------------ARAAAGAPTSEA
A0A667HYB7_PMAIP1-      ------------------------------------EESAGAGRRSDLRG
A0A671EYM5_PMAIP1-      ---------------------------------------VGSCFSPEPEV
A0A4W4H0G9_PMAIP1-      --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A5F4CR18_PMAIP1-      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
                                                                          

Q9GL49_PMAIP1-01        FGPPPAAVR-GNQPTSE-AFGRSGCCFSSSLPLARFCPTAPRAACYLQSQ
A0A669QIC6_PMAIP1-      --MPGRTIR-KPAPPAA-PAGRERRREAGLNFFTGVDTGKKQAFPFFFSF
A0A2I2YVQ5_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAG-----PAGTARDQAGFGIEMQLRFTR
A0A2I3SX38_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAG-----PAGTARDQAGFGIGMQLRFTR
A0A2I3HX97_PMAIP1-      --SLG-EAR-RNAQPSP-APAPAGTDPLGTAGTARNQAGFGIGMQLRFTR
A0A2K5JY17_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAG---TDPLGPAKTQAGRGRG------R
A0A2K5NJZ2_PMAIP1-      --MPGKKAR-KNAQPSP-MRAQAG--QAGTAGTARDQAGFGIGMQLHFTR
A0A2K6BV43_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAG--PAGTAGTARDQAGFGIGMQLHYTR
A0A2K5ZWH1_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAG--QAGTAGTARDQAGFGIGMQLHFTR
A0A096MPU8_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAG--QAGTAGTARDQAGFGIGMQLHFTR
A0A2K6KJF1_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAG--PAGTAGTARDQAGLGIGMQLHFTR
A0A2K6NC45_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAG--PAGTAGTARDQAGLGIGMQLHFTR
Q13794_PMAIP1-02        --MPGKKAR-KNAQPSP-ARAPAG--PAGTAGTARDQAGFAIGMQLRFTR
A0A2R9AKC9_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAG--P---AGTARDQAGFGIGMQLRFTR
A0A286XF37_PMAIP1-      --MPGKVCK-SAQP-NS-TRAELE--VECAAQLRR--------------V
Q9JM54_PMAIP1-01        --MPGRKAR-RNAPVNP-TRAELP--PEFAAQLRK--------------I
Q5U777_PMAIP1-01        --MPGRKAR-RNAPLNP-TRAELP--PEFAAQLRK--------------I
A0A4X1TQ35_PMAIP1-      FGRSGCCFS-SSLPLAR-FCP-TA--PRAACYLQS--------------Q
F1SMU1_PMAIP1-01        FGRSGCCFS-SSLPLAR-FCP-TA--PRAACYLQS--------------Q
A0A667HYB7_PMAIP1-      ARASLSSLV-ELGPAAP-VRP-VP--PR-ACSSRA--------------A
A0A671EYM5_PMAIP1-      LGYPLSAVS-SRLPSGP-ARP-PG--AQ-LASCRP--------------Q
A0A4W4H0G9_PMAIP1-      -KQAGTSPV-TPCQLIS-WLSDLF--------------------------
A0A3B5RFA9_PMAIP1-      --LPAAAEL-----------------------------------------
A0A0P0HZF9_PMAIP1-      --MA------KKEKTAV---------------------------------
Q0GKC8_PMAIP1-01        --MA------KKEQTAV---------------------------------
A0A674HDV6_PMAIP1-      --MPGRTLR-KTAPPAAPAA------------------------------
A0A5F4CR18_PMAIP1-      ---PARAAR-DQHGPGP-GGAPKQ--------------------------
A0A5F8ATY0_PMAIP1-      --MPSKNEK-TNLQPQP-TNQQME--------------------------
A0A663N909_PMAIP1-      --LPGHHHK-RRCGWLT-AVLVPS--------------------------
A0A1D5PAR2_PMAIP1-      -MMPGRTIR-K-----P-APPAAP--------------------------
A0A670IXL8_PMAIP1-      --MPSQRLE-LQLPPAP-ASTTND--------------------------
A0A5F9C629_PMAIP1-      --MPGKRAR-KRSQSSP-KRAPAE--------------------------
A0A2K6EM90_PMAIP1-      --MPVKKAR-KNAQPSP-TRTRAE--------------------------
Q9JM54_PMAIP1-03        --MPGKSQKSRMRSPSP-TRVPAD--------------------------
G1P8F9_PMAIP1-01        --MPGKKAR-KNAQPSP-TRAPAE--------------------------
G3T0P7_PMAIP1-01        --MPGKKAR-KSAQPGP-AGTPAG--------------------------
A0A3Q2I0H2_PMAIP1-      --MPTRKAR-KSGQPSP-TRAPAE--------------------------
Q1PCT2_PMAIP1-01        --MPGRKAR-KSAQPGP-TRAPEE--------------------------
A0A452STA4_PMAIP1-      --MPGKKAR-KSAQASP-ARTPAE--------------------------
A0A2K5NJZ2_PMAIP1-      --MPGKKAR-KNAQPSP-MRAQAE--------------------------
A0A0D9S003_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAE--------------------------
A0A2K6BV43_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAE--------------------------
A0A2K5ZWH1_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAE--------------------------
A0A096MPU8_PMAIP1-      --MPGKKAR-KNAQPSP-TRAQAE--------------------------
A0A2K5JY17_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAE--------------------------
A0A2K6KJF1_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAE--------------------------
A0A2K6NC45_PMAIP1-      --MPGKKAR-KNAQPSP-ARAQAE--------------------------
A0A2K6S6C4_PMAIP1-      --MPGKKAR-KSAQPSP-ARAPAD--------------------------
A0A2I2YVQ5_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAE--------------------------
Q13794_PMAIP1-01        --MPGKKAR-KNAQPSP-ARAPAE--------------------------
A0A2R9AKC9_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAE--------------------------
A0A2I3SX38_PMAIP1-      --MPGKKAR-KNAQPSP-ARAPAE--------------------------
H2NWG2_PMAIP1-01        --MPGKKAR-KNAQPSP-ARAPAE--------------------------
A0A2K5CFK7_PMAIP1-      --MPGKKAR-KSAQPSP-SRAPAD--------------------------
F7GW45_PMAIP1-01        --MPGKKAR-KSAQPSP-ARAPAD--------------------------
A0A2K5QQC6_PMAIP1-      --MPGKKAR-KSAQPSP-APAPAD--------------------------
A0A337SUX1_PMAIP1-      --MPGKRTR-KSAQPSP-ARAPAE--------------------------
A0A673UI19_PMAIP1-      --MPGKKAR-KSAQPSP-ARAPAE--------------------------
A0A2Y9P485_PMAIP1-      --MPGRRVR-KSAQQSP-TRAPAD--------------------------
A0A2Y9TJ73_PMAIP1-      --MPGRRAR-KSAQQSP-TRAPAD--------------------------
A0A4W2CDL0_PMAIP1-      --MPGRRAR-KSAQPSP-TRVPAD--------------------------
A0A3Q1NFP6_PMAIP1-      --MPGRRAR-KSAQPSP-TRVPAD--------------------------
A0A4W2CDL0_PMAIP1-      --MPGRRAR-KSAQPSP-TRVPAD--------------------------
A0A452EST2_PMAIP1-      --MPGRRAR-RSAQPSP-TRVPAD--------------------------
W5P738_PMAIP1-01        --MPGRRAR-RSAQPSP-TRVPAD--------------------------
Q9JM54_PMAIP1-02        --MPGRKAR-RNAPVNP---TRAD--------------------------
A0A2I3HX97_PMAIP1-      ---KPGRAR-RNAQPSP-APAPAE--------------------------
G1LIZ7_PMAIP1-01        --IGSLLSG-EPASPSP-SAAPPP--------------------------
A0A452TE71_PMAIP1-      --WGSLLSG-EPASPSP-SAAPPP--------------------------
A0A452J430_PMAIP1-      --MPGKTLR-KGAQQNP-ALPAQE--------------------------
A0A493SWX7_PMAIP1-      --MPCRTLR-KPAQPSA----ERQ--------------------------
A0A674JUE0_PMAIP1-      --VRGTKFG-SRFEPPP----TQE--------------------------
A0A7M4FB17_PMAIP1-      --QSGRDSD-TSASPAPAMLPERE--------------------------
A0A663FH84_PMAIP1-      --MPGRTLR-KAAPPAAP--AGRE--------------------------
A0A670ZS96_PMAIP1-      --RGGKERQ-RTAASTE------E--------------------------
                                                                          

Q9GL49_PMAIP1-01        GARVRGLSSRS---FAAKFRLLFAEMPGRRSRRNT---QTNPTRVALPPD
A0A669QIC6_PMAIP1-      ---FFSTVFFPSPISLSGKDLVRIKSPSPCACFAE---------------
A0A2I2YVQ5_PMAIP1-      GKKLLSSS----PLALPRGHEEQVQVAGSRVCYST---QEIWRQTELPAE
A0A2I3SX38_PMAIP1-      GKKLLSSSLSSWPLALPRGHEEQVQVAGSRVCYST---QEIWRQTELPAE
A0A2I3HX97_PMAIP1-      GKKLLSSSLSSSPLALPRGHEEQVQV---RTSLSR---QK--GQTELPAE
A0A2K5JY17_PMAIP1-      GKKLL-----SSPLALPRGHEEQVQVARSRVCYST---QEIWRQTELPAE
A0A2K5NJZ2_PMAIP1-      GKELV----SSSPLALPRGREEQVQVARSRVCYST---QEIWRQTELPAE
A0A2K6BV43_PMAIP1-      GKKLV----SSSPLVLPRGHEEQVQVARSRVCYST---QEIWRQTKLPAE
A0A2K5ZWH1_PMAIP1-      GKKLV----SSSPLALPRGHEEQVQVARSRVCYST---QEIWRQTELPAE
A0A096MPU8_PMAIP1-      SKKLV----SSSPLALPRGHEEQVQVARSRVCYST---QEIWRQTELPAE
A0A2K6KJF1_PMAIP1-      GKKLL----SSSPLALPRGHEEQVQVARSRVCYST---QEIWRQTELPAE
A0A2K6NC45_PMAIP1-      GKKLL----SSSPLALPRGHEEQVQVARSRVCYST---QEIWRQTELPAE
Q13794_PMAIP1-02        GKKLLSSSLSSSPLALPRGHEEQVQVAGSRVCYST---QEIWRQTELPAE
A0A2R9AKC9_PMAIP1-      GKKLLSSS-SSSPLALPRGHEEQAQVAGSRVCYST---QEIWRQTELPAE
A0A286XF37_PMAIP1-      GDTLNSLG------CTTEALEVLAEMAGKKARKSS---EPDPARA--RAE
Q9JM54_PMAIP1-01        GDKV------YCTWSAPDITVVLAQMPGKSQKSRM--RSPSPTRV--PAD
Q5U777_PMAIP1-01        GDKV------YCTWSAPDITAVLAQMPGKKSRKSTMRRSPSPTRV--PAD
A0A4X1TQ35_PMAIP1-      GARVRGLSSRS---FAAKFRLLFAEMPGRRSRRNT---QTNPTRVALPPD
F1SMU1_PMAIP1-01        GARVRGLSSRS---FAAKFRLLFAEMPGRRSRRNT---QTNPTRVALPPD
A0A667HYB7_PMAIP1-      APRCSGWGTENPGLLRHGGRRPLAEMPGKRTRKSA---QPSPARA--PAE
A0A671EYM5_PMAIP1-      GA-TQGWGTEFPGGLQQTSRRLLAEMPGKKARKNA---QPSPTRA--PAE
A0A4W4H0G9_PMAIP1-      --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A5F4CR18_PMAIP1-      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
                                                                          

Q9GL49_PMAIP1-01        PE------------VECAIQFRRIGDKLNFRQKLLNLIAKL-----FRLG
A0A669QIC6_PMAIP1-      ----------RDAVAECALELRRIGDKADLRQKVLNLIAKL-----FCPK
A0A2I2YVQ5_PMAIP1-      TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEER-----LHCN
A0A2I3SX38_PMAIP1-      TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEER-----LHCN
A0A2I3HX97_PMAIP1-      TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRRTFHQFEER-----LHCN
A0A2K5JY17_PMAIP1-      TSESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEAR-----LHCN
A0A2K5NJZ2_PMAIP1-      TSESDSQTLLLRNLTASNTCIRGLQKRLFLRRCTLHQFEER-----LHCN
A0A2K6BV43_PMAIP1-      TSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEER-----LHCN
A0A2K5ZWH1_PMAIP1-      TSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCILHKFEER-----LHCN
A0A096MPU8_PMAIP1-      TSESDSQTLLLRNLTASKTCIGGLQKRLFLRRCTLHQFEER-----LHCN
A0A2K6KJF1_PMAIP1-      TFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEER-----LHCN
A0A2K6NC45_PMAIP1-      TFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEER-----LHCN
Q13794_PMAIP1-02        TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEER-----LHCN
A0A2R9AKC9_PMAIP1-      TSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEER-----LHCN
A0A286XF37_PMAIP1-      LE------------VECAAQLRRIGDKLNFQQKLMYLISKL-----ISLV
Q9JM54_PMAIP1-01        LK------------DECA-QLRRIGDKVNLRQKLLNLISKL-----FNLV
Q5U777_PMAIP1-01        LK------------DECD-QLRRIGDKVNLRQKLLNFISKL-----FNLI
A0A4X1TQ35_PMAIP1-      PE------------VECAIQFRRIGDKLNFRQKLLNLIAKL-----FRLG
F1SMU1_PMAIP1-01        PE------------VECAIQFRRIGDKLNFRQKLLNLIAKL-----FRLG
A0A667HYB7_PMAIP1-      PE------------VECAMQLRRFGDKLNFRQKLMNLISKL-----FRSG
A0A671EYM5_PMAIP1-      LE------------VECAIQFRRIGDKLSFRQKLLNLISKL-----FRSG
A0A4W4H0G9_PMAIP1-      --------LEQTVVSECACQLRRMGDLINWKYLLLHLIADARTRLGICSG
A0A3B5RFA9_PMAIP1-      ----------------CARELRQVGDKLYWRYKLLEMLLKN-----YETL
A0A0P0HZF9_PMAIP1-      --------------VECAQQLRTIGDLFDWKYKLLEIIIAL-----QKAQ
Q0GKC8_PMAIP1-01        --------------VECAQQLRNIGDLLNWKYKLLELIVTL-----QKIQ
A0A674HDV6_PMAIP1-      --------------VECALELTRIGDRWDLRQRLLNLLAKL-----FCPG
A0A5F4CR18_PMAIP1-      --------LS----FECEITLEKYHPFITTKKKMINMLSQV-----LRNG
A0A5F8ATY0_PMAIP1-      --------LQ----IQFAKRKRAFGGRLNRRDKSLALSPRL-----ECSG
A0A663N909_PMAIP1-      --------AEREAVAECALQLRRIGDKWDLRQKILNLLTKL-----FCPE
A0A1D5PAR2_PMAIP1-      --------AERDAVAECALELRRIGDKADLQQKVLNLITKL-----FCPK
A0A670IXL8_PMAIP1-      --------SE--AVRECALQLRRMGDKWNLRQKILNLISKL-----FCPE
A0A5F9C629_PMAIP1-      --------LE----VECATQLRIIGDKLDLRRKLLNLISKF-----FNFV
A0A2K6EM90_PMAIP1-      --------IE----EECALQLRRLGDKLHFQQKLLNLIAKL-----FRSG
Q9JM54_PMAIP1-03        --------LK----DECA-QLRRIGDKVNLRQKLLNLISKL-----FNLV
G1P8F9_PMAIP1-01        --------AE----IECALQLRRIGDKLSFLQKLLNLMYKL-----FGSG
G3T0P7_PMAIP1-01        --------TQQRDVVECAIQLRRIGDKINFRQKLLNVICKL-----FCSG
A0A3Q2I0H2_PMAIP1-      --------LE----AECAIQIRRIGDKLNFRQKLLNLIAKL-----FRSG
Q1PCT2_PMAIP1-01        --------LE----VECAIQLRKFGDKLNFRQKLLNLLSKL-----FRSG
A0A452STA4_PMAIP1-      --------PE----VECAIQLRRFGDKLNFRQKLLNLISKL-----FRSG
A0A2K5NJZ2_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A0D9S003_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K6BV43_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K5ZWH1_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A096MPU8_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K5JY17_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K6KJF1_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K6NC45_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLIAKL-----FCSG
A0A2K6S6C4_PMAIP1-      --------LE----VECAIQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A2I2YVQ5_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
Q13794_PMAIP1-01        --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A2R9AKC9_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A2I3SX38_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
H2NWG2_PMAIP1-01        --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A2K5CFK7_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
F7GW45_PMAIP1-01        --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A2K5QQC6_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
A0A337SUX1_PMAIP1-      --------PE----VECAMQLRRFGDKLNFRQKLMNLISKL-----FRSG
A0A673UI19_PMAIP1-      --------PE----VECAMQLRRIGDKLNFRQKLMNLIAKL-----FRSG
A0A2Y9P485_PMAIP1-      --------PE----VECAIQFRRIGDKLNFRQKLLNLISKL-----FRSG
A0A2Y9TJ73_PMAIP1-      --------PE----VECAIQFRRIGDKLNFRQKLLNLISKL-----FRSG
A0A4W2CDL0_PMAIP1-      --------PE----VECAIQLRRIGDKLNFRQKLVNLISKL-----LRSG
A0A3Q1NFP6_PMAIP1-      --------PE----VECAIQLRRIGDKLNFRQKLVNLISKL-----LRSG
A0A4W2CDL0_PMAIP1-      --------PE----VECAIQLRRIGDKLNFRQKLVNLISKL-----LRSG
A0A452EST2_PMAIP1-      --------PE----VECAIQLRRIGDKLNFRQKLVNLIAKL-----LRSG
W5P738_PMAIP1-01        --------PE----VECAIQLRRIGDKLNFRQKLVNLIAKL-----LRSG
Q9JM54_PMAIP1-02        --------LK----DECA-QLRRIGDKVNLRQKLLNLISKL-----FNLV
A0A2I3HX97_PMAIP1-      --------LE----VECATQLRRFGDKLNFRQKLLNLISKL-----FCSG
G1LIZ7_PMAIP1-01        ---------E----VECAIQLRRFGDKLNFRQKLLNLISKL-----FRSG
A0A452TE71_PMAIP1-      ---------E----VECAIQLRRFGDKLNFRQKLLNLISKL-----FRSG
A0A452J430_PMAIP1-      --------AV----TQCSLQLRKIGDICNLQQKILNVITKL-----FCPG
A0A493SWX7_PMAIP1-      --------AV----AECALELRRIGDKADFRQRILNLITKL-----FCPK
A0A674JUE0_PMAIP1-      --------AV----MQCSLQLRKIGDICNLQQKILNVITKL-----FCPG
A0A7M4FB17_PMAIP1-      --------AV----RECALQLRRIGDQCHLHQKILGLIAKL-----FRPG
A0A663FH84_PMAIP1-      --------VE----AQCALQLRRIGDKWDLRQKILNLLTKL-----FFPE
A0A670ZS96_PMAIP1-      --------CS----VMIALQLRRIGDKWNLRQRILNLFSKL-----FCPG
                                                          .               

Q9GL49_PMAIP1-01        T-----------------------------
A0A669QIC6_PMAIP1-      T-----------------------------
A0A2I2YVQ5_PMAIP1-      WEECEGAFMGALGNGRWNTSK---------
A0A2I3SX38_PMAIP1-      W-----------------------------
A0A2I3HX97_PMAIP1-      ------------------------------
A0A2K5JY17_PMAIP1-      ------------------------------
A0A2K5NJZ2_PMAIP1-      W-----------------------------
A0A2K6BV43_PMAIP1-      W-----------------------------
A0A2K5ZWH1_PMAIP1-      W-----------------------------
A0A096MPU8_PMAIP1-      W-----------------------------
A0A2K6KJF1_PMAIP1-      W-----------------------------
A0A2K6NC45_PMAIP1-      W-----------------------------
Q13794_PMAIP1-02        ------------------------------
A0A2R9AKC9_PMAIP1-      W-----------------------------
A0A286XF37_PMAIP1-      T-----------------------------
Q9JM54_PMAIP1-01        T-----------------------------
Q5U777_PMAIP1-01        T-----------------------------
A0A4X1TQ35_PMAIP1-      T-----------------------------
F1SMU1_PMAIP1-01        T-----------------------------
A0A667HYB7_PMAIP1-      T-----------------------------
A0A671EYM5_PMAIP1-      T-----------------------------
A0A4W4H0G9_PMAIP1-      NDVVALCM----------------------
A0A3B5RFA9_PMAIP1-      NKIK--------------------------
A0A0P0HZF9_PMAIP1-      TDGKR-------------------------
Q0GKC8_PMAIP1-01        MEGKR-------------------------
A0A674HDV6_PMAIP1-      TWAARGHGERNGGGPWLCGFGRRGSTDTGR
A0A5F4CR18_PMAIP1-      K-----------------------------
A0A5F8ATY0_PMAIP1-      P-----------------------------
A0A663N909_PMAIP1-      T-----------------------------
A0A1D5PAR2_PMAIP1-      T-----------------------------
A0A670IXL8_PMAIP1-      T-----------------------------
A0A5F9C629_PMAIP1-      P-----------------------------
A0A2K6EM90_PMAIP1-      T-----------------------------
Q9JM54_PMAIP1-03        T-----------------------------
G1P8F9_PMAIP1-01        T-----------------------------
G3T0P7_PMAIP1-01        T-----------------------------
A0A3Q2I0H2_PMAIP1-      T-----------------------------
Q1PCT2_PMAIP1-01        T-----------------------------
A0A452STA4_PMAIP1-      T-----------------------------
A0A2K5NJZ2_PMAIP1-      T-----------------------------
A0A0D9S003_PMAIP1-      T-----------------------------
A0A2K6BV43_PMAIP1-      T-----------------------------
A0A2K5ZWH1_PMAIP1-      T-----------------------------
A0A096MPU8_PMAIP1-      T-----------------------------
A0A2K5JY17_PMAIP1-      T-----------------------------
A0A2K6KJF1_PMAIP1-      T-----------------------------
A0A2K6NC45_PMAIP1-      T-----------------------------
A0A2K6S6C4_PMAIP1-      T-----------------------------
A0A2I2YVQ5_PMAIP1-      T-----------------------------
Q13794_PMAIP1-01        T-----------------------------
A0A2R9AKC9_PMAIP1-      T-----------------------------
A0A2I3SX38_PMAIP1-      T-----------------------------
H2NWG2_PMAIP1-01        T-----------------------------
A0A2K5CFK7_PMAIP1-      T-----------------------------
F7GW45_PMAIP1-01        T-----------------------------
A0A2K5QQC6_PMAIP1-      T-----------------------------
A0A337SUX1_PMAIP1-      T-----------------------------
A0A673UI19_PMAIP1-      T-----------------------------
A0A2Y9P485_PMAIP1-      T-----------------------------
A0A2Y9TJ73_PMAIP1-      T-----------------------------
A0A4W2CDL0_PMAIP1-      T-----------------------------
A0A3Q1NFP6_PMAIP1-      T-----------------------------
A0A4W2CDL0_PMAIP1-      T-----------------------------
A0A452EST2_PMAIP1-      T-----------------------------
W5P738_PMAIP1-01        T-----------------------------
Q9JM54_PMAIP1-02        T-----------------------------
A0A2I3HX97_PMAIP1-      T-----------------------------
G1LIZ7_PMAIP1-01        T-----------------------------
A0A452TE71_PMAIP1-      T-----------------------------
A0A452J430_PMAIP1-      T-----------------------------
A0A493SWX7_PMAIP1-      T-----------------------------
A0A674JUE0_PMAIP1-      T-----------------------------
A0A7M4FB17_PMAIP1-      T-----------------------------
A0A663FH84_PMAIP1-      T-----------------------------
A0A670ZS96_PMAIP1-      T-----------------------------
                                                      

© 1998-2022Legal notice