Dataset for protein Noxa of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

53 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493SWX7_PMAIP1-      -----------------------------------------MPCRTLR-K
A0A2I3HX97_PMAIP1-      ------------------------------------------KPGRAR-R
A0A452TE71_PMAIP1-      -----------------------------------------WGSLLSG-E
A0A452J430_PMAIP1-      -----------------------------------------MPGKTLR-K
A0A1D5PAR2_PMAIP1-      ----------------------------------------MMPGRTIR--
A0A2K6EM90_PMAIP1-      -----------------------------------------MPVKKAR-K
G1P8F9_PMAIP1-01        -----------------------------------------MPGKKAR-K
Q9JM54_PMAIP1-03        -----------------------------------------MPGKSQKSR
A0A3Q2I0H2_PMAIP1-      -----------------------------------------MPTRKAR-K
G3T0P7_PMAIP1-01        -----------------------------------------MPGKKAR-K
Q1PCT2_PMAIP1-01        -----------------------------------------MPGRKAR-K
G1LIZ7_PMAIP1-01        -----------------------------------------MPGKKAR-K
A0A452STA4_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5NJZ2_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A0D9S003_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5VPX2_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6BV43_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5ZWH1_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A096MPU8_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5JY17_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6KJF1_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6NC45_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6S6C4_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2I2YVQ5_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2R9AKC9_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKAR-K
H2NWG2_PMAIP1-01        -----------------------------------------MPGKKAR-K
A0A2K5CFK7_PMAIP1-      -----------------------------------------MPGKKAR-K
F7GW45_PMAIP1-01        -----------------------------------------MPGKKAR-K
A0A2K5QQC6_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A337SUX1_PMAIP1-      -----------------------------------------MPGKRTR-K
A0A3Q1NFP6_PMAIP1-      -----------------------------------------MPGRRAR-K
A0A452EST2_PMAIP1-      -----------------------------------------MPGRRAR-R
W5P738_PMAIP1-01        -----------------------------------------MPGRRAR-R
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      -------------------------------------------------M
Q0GKC8_PMAIP1-01        -------------------------------------------------M
Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELR-G
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2I3SX38_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5JY17_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2R9AKC9_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6KJF1_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6NC45_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A096MPU8_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5ZWH1_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K5VPX2_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A2K6BV43_PMAIP1-      -----------------------------------------MPGKKAR-K
A0A286XF37_PMAIP1-      -----------------------------------------MPGKVCK-S
A0A1U7QLK6_PMAIP1-      -----------------------------------------MLQSVAR-Q
Q9JM54_PMAIP1-01        -----------------------------------------MPGRKAR-R
Q5U777_PMAIP1-01        -----------------------------------------MPGRKAR-R
                                                                          

A0A493SWX7_PMAIP1-      PAQPSAERQAV-------AECALEL-------------------------
A0A2I3HX97_PMAIP1-      NAQPSPAPAPAELE----VECATQL-------------------------
A0A452TE71_PMAIP1-      PASPSPSAAPPP-E----VECAIQL-------------------------
A0A452J430_PMAIP1-      GAQQNPALPAQEAV----TQCSLQL-------------------------
A0A1D5PAR2_PMAIP1-      --KPAPPAAPAERD--AVAECALEL-------------------------
A0A2K6EM90_PMAIP1-      NAQPSPTRTRAEIE----EECALQL-------------------------
G1P8F9_PMAIP1-01        NAQPSPTRAPAEAE----IECALQL-------------------------
Q9JM54_PMAIP1-03        MRSPSPTRVPADLK----DECA-QL-------------------------
A0A3Q2I0H2_PMAIP1-      SGQPSPTRAPAELE----AECAIQI-------------------------
G3T0P7_PMAIP1-01        SAQPGPAGTPAGTQQRDVVECAIQL-------------------------
Q1PCT2_PMAIP1-01        SAQPGPTRAPEELE----VECAIQL-------------------------
G1LIZ7_PMAIP1-01        SAQASPARTRGQPE----VECAIQL-------------------------
A0A452STA4_PMAIP1-      SAQASPARTPAEPE----VECAIQL-------------------------
A0A2K5NJZ2_PMAIP1-      NAQPSPMRAQAELE----VECATQL-------------------------
A0A0D9S003_PMAIP1-      NAQPSPTRAQAELE----VECATQL-------------------------
A0A2K5VPX2_PMAIP1-      NAQPSPTRAQAELE----VECATQL-------------------------
A0A2K6BV43_PMAIP1-      NAQPSPTRAQAELE----VECATQL-------------------------
A0A2K5ZWH1_PMAIP1-      NAQPSPTRAQAELE----VECATQL-------------------------
A0A096MPU8_PMAIP1-      NAQPSPTRAQAELE----VECATQL-------------------------
A0A2K5JY17_PMAIP1-      NAQPSPARAQAELE----VECATQL-------------------------
A0A2K6KJF1_PMAIP1-      NAQPSPARAQAELE----VECATQL-------------------------
A0A2K6NC45_PMAIP1-      NAQPSPARAQAELE----VECATQL-------------------------
A0A2K6S6C4_PMAIP1-      SAQPSPARAPADLE----VECAIQL-------------------------
A0A2I2YVQ5_PMAIP1-      NAQPSPARAPAELE----VECATQL-------------------------
A0A2R9AKC9_PMAIP1-      NAQPSPARAPAELE----VECATQL-------------------------
A0A2I3SX38_PMAIP1-      NAQPSPARAPAELE----VECATQL-------------------------
H2NWG2_PMAIP1-01        NAQPSPARAPAELE----VECATQL-------------------------
A0A2K5CFK7_PMAIP1-      SAQPSPSRAPADLE----VECATQL-------------------------
F7GW45_PMAIP1-01        SAQPSPARAPADLE----VECATQL-------------------------
A0A2K5QQC6_PMAIP1-      SAQPSPAPAPADLE----VECATQL-------------------------
A0A337SUX1_PMAIP1-      SAQPSPARAPAEPE----VECAMQL-------------------------
A0A3Q1NFP6_PMAIP1-      SAQPSPTRVPADPE----VECAIQL-------------------------
A0A452EST2_PMAIP1-      SAQPSPTRVPADPE----VECAIQL-------------------------
W5P738_PMAIP1-01        SAQPSPTRVPADPE----VECAIQL-------------------------
A0A3B5RFA9_PMAIP1-      ---LPAAA----------ELCAREL-------------------------
A0A0P0HZF9_PMAIP1-      AKKEKTAV----------VECAQQL-------------------------
Q0GKC8_PMAIP1-01        AKKEQTAV----------VECAQQL-------------------------
Q9GL49_PMAIP1-01        SFGPPPAAVRGNQP----TSEAFGRSGCCFSSSLPLARFCPTAPRAACYL
F1SMU1_PMAIP1-01        ------ARAAAGAP----TSEAFGRSGCCFSSSLPLARFCPTAPRAACYL
A0A2I2YVQ5_PMAIP1-      NAQPSPARAPAGP-------AGTARDQAGFGIEMQL-RFTRGKKLL---S
A0A2I3SX38_PMAIP1-      NAQPSPARAPAGP-------AGTARDQAGFGIGMQL-RFTRGKKLL---S
A0A2K5JY17_PMAIP1-      NAQPSPARAQAGT-----DPLGPAKTQAGRGRG-------RGKKLL----
A0A2R9AKC9_PMAIP1-      NAQPSPARAPAGP-------AGTARDQAGFGIGMQL-RFTRGKKLLSSSS
A0A2K6KJF1_PMAIP1-      NAQPSPARAQAGPA----GTAGTARDQAGLGIGMQL-HFTRGKKLL---S
A0A2K6NC45_PMAIP1-      NAQPSPARAQAGPA----GTAGTARDQAGLGIGMQL-HFTRGKKLL---S
A0A096MPU8_PMAIP1-      NAQPSPTRAQAGQA----GTAGTARDQAGFGIGMQL-HFTRSKKLV---S
A0A2K5ZWH1_PMAIP1-      NAQPSPTRAQAGQA----GTAGTARDQAGFGIGMQL-HFTRGKKLV---S
A0A2K5VPX2_PMAIP1-      NAQPSPTRAQAGQA----GTAGTARDQAGFGIGMQL-HYTRGKKLV---S
A0A2K6BV43_PMAIP1-      NAQPSPTRAQAGPA----GTAGTARDQAGFGIGMQL-HYTRGKKLV---S
A0A286XF37_PMAIP1-      AQP-NSTRAELEVE----CAAQLRR---------------VGDTLNSLGC
A0A1U7QLK6_PMAIP1-      NAPSNPARAELAPE----FIAQLRR---------------IGDKLSSEWC
Q9JM54_PMAIP1-01        NAPVNPTRAELPPE----FAAQLRK---------------IGDKVYCTWS
Q5U777_PMAIP1-01        NAPLNPTRAELPPE----FAAQLRK---------------IGDKVYCTWS
                                                                          

A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
Q1PCT2_PMAIP1-01        --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A096MPU8_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
F7GW45_PMAIP1-01        --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
Q9GL49_PMAIP1-01        QS----QGARVRGLSSRSFAAKFRLLFA--------EMPGRRSRRNTQTN
F1SMU1_PMAIP1-01        QS----QGARVRGLSSRSFAAKFRLLFA--------EMPGRRSRRNTQTN
A0A2I2YVQ5_PMAIP1-      SS----PLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTL
A0A2I3SX38_PMAIP1-      SSLSSWPLALPRGHEEQVQVAGSRVCYSTQEIWRQTELPAETSESDIQTL
A0A2K5JY17_PMAIP1-      SS----PLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A2R9AKC9_PMAIP1-      SS----PLALPRGHEEQAQVAGSRVCYSTQEIWRQTELPAETSESDIQTL
A0A2K6KJF1_PMAIP1-      SS----PLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTL
A0A2K6NC45_PMAIP1-      SS----PLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQTL
A0A096MPU8_PMAIP1-      SS----PLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A2K5ZWH1_PMAIP1-      SS----PLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A2K5VPX2_PMAIP1-      SS----PLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAETSESDSQTL
A0A2K6BV43_PMAIP1-      SS----PLVLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTL
A0A286XF37_PMAIP1-      TTEALEVLAEMAGKKARKS---SEPD--------PARARAELEVECAAQL
A0A1U7QLK6_PMAIP1-      EPDIIAVLAEMPGKKARKSVT-RIPS--------PTRVPTDVEDECVHQL
Q9JM54_PMAIP1-01        APDITVVLAQMPGKSQKSRM--RSPS--------PTRVPADLKDEC-AQL
Q5U777_PMAIP1-01        APDITAVLAQMPGKKSRKSTMRRSPS--------PTRVPADLKDEC-DQL
                                                                          

A0A493SWX7_PMAIP1-      ------------------RRIGDKADFRQRILNLITKLFCPKT-------
A0A2I3HX97_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A452TE71_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFRSGT-------
A0A452J430_PMAIP1-      ------------------RKIGDICNLQQKILNVITKLFCPGT-------
A0A1D5PAR2_PMAIP1-      ------------------RRIGDKADLQQKVLNLITKLFCPKT-------
A0A2K6EM90_PMAIP1-      ------------------RRLGDKLHFQQKLLNLIAKLFRSGT-------
G1P8F9_PMAIP1-01        ------------------RRIGDKLSFLQKLLNLMYKLFGSGT-------
Q9JM54_PMAIP1-03        ------------------RRIGDKVNLRQKLLNLISKLFNLVT-------
A0A3Q2I0H2_PMAIP1-      ------------------RRIGDKLNFRQKLLNLIAKLFRSGT-------
G3T0P7_PMAIP1-01        ------------------RRIGDKINFRQKLLNVICKLFCSGT-------
Q1PCT2_PMAIP1-01        ------------------RKFGDKLNFRQKLLNLLSKLFRSGT-------
G1LIZ7_PMAIP1-01        ------------------RRFGDKLNFRQKLLNLISKLFRSGT-------
A0A452STA4_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFRSGT-------
A0A2K5NJZ2_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A0D9S003_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K5VPX2_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K6BV43_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K5ZWH1_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A096MPU8_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K5JY17_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K6KJF1_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K6NC45_PMAIP1-      ------------------RRFGDKLNFRQKLLNLIAKLFCSGT-------
A0A2K6S6C4_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2I2YVQ5_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2R9AKC9_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2I3SX38_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
H2NWG2_PMAIP1-01        ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2K5CFK7_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
F7GW45_PMAIP1-01        ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A2K5QQC6_PMAIP1-      ------------------RRFGDKLNFRQKLLNLISKLFCSGT-------
A0A337SUX1_PMAIP1-      ------------------RRFGDKLNFRQKLMNLISKLFRSGT-------
A0A3Q1NFP6_PMAIP1-      ------------------RRIGDKLNFRQKLVNLISKLLRSGT-------
A0A452EST2_PMAIP1-      ------------------RRIGDKLNFRQKLVNLIAKLLRSGT-------
W5P738_PMAIP1-01        ------------------RRIGDKLNFRQKLVNLIAKLLRSGT-------
A0A3B5RFA9_PMAIP1-      ------------------RQVGDKLYWRYKLLEMLLKNYETLNKIK----
A0A0P0HZF9_PMAIP1-      ------------------RTIGDLFDWKYKLLEIII----ALQKAQTDGK
Q0GKC8_PMAIP1-01        ------------------RNIGDLLNWKYKLLELIV----TLQKIQMEGK
Q9GL49_PMAIP1-01        PTRVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT-------
F1SMU1_PMAIP1-01        PTRVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT-------
A0A2I2YVQ5_PMAIP1-      LLRNLTASKTCM------RGLLQKSFLRRCTFHQFEERLHCNWEECEGAF
A0A2I3SX38_PMAIP1-      LLRNLTASKTCM------RGLLQKSFLRRCTFHQFEERLHCNW-------
A0A2K5JY17_PMAIP1-      LLRNLTATKTCM------RGLQKRIFLRRCTFHQFEARLHCN--------
A0A2R9AKC9_PMAIP1-      LLRNLTASKTCM------RGLLQKSFLRRCTFHQFEERLHCNW-------
A0A2K6KJF1_PMAIP1-      LLRNLTASKTCI------RGLQTRIFLRRCTFHQFEERLHCNW-------
A0A2K6NC45_PMAIP1-      LLRNLTASKTCI------RGLQTRIFLRRCTFHQFEERLHCNW-------
A0A096MPU8_PMAIP1-      LLRNLTASKTCI------GGLQKRLFLRRCTLHQFEERLHCNW-------
A0A2K5ZWH1_PMAIP1-      LLRNLTASKTCI------RGLQKRLFLRRCILHKFEERLHCNW-------
A0A2K5VPX2_PMAIP1-      LLRNLTASKTCI------RGLQKRLFLRRCTLHQFEERLHCNW-------
A0A2K6BV43_PMAIP1-      LLRNLTASKTCI------RGLQKRLFLRRCTLHQFEERLHCNW-------
A0A286XF37_PMAIP1-      ------------------RRIGDKLNFQQKLMYLISKLISLVT-------
A0A1U7QLK6_PMAIP1-      ------------------RRIGDKQNLRQKLLNFISKLFSLVT-------
Q9JM54_PMAIP1-01        ------------------RRIGDKVNLRQKLLNLISKLFNLVT-------
Q5U777_PMAIP1-01        ------------------RRIGDKVNLRQKLLNFISKLFNLIT-------
                                            .          .  :               

A0A493SWX7_PMAIP1-      -------------
A0A2I3HX97_PMAIP1-      -------------
A0A452TE71_PMAIP1-      -------------
A0A452J430_PMAIP1-      -------------
A0A1D5PAR2_PMAIP1-      -------------
A0A2K6EM90_PMAIP1-      -------------
G1P8F9_PMAIP1-01        -------------
Q9JM54_PMAIP1-03        -------------
A0A3Q2I0H2_PMAIP1-      -------------
G3T0P7_PMAIP1-01        -------------
Q1PCT2_PMAIP1-01        -------------
G1LIZ7_PMAIP1-01        -------------
A0A452STA4_PMAIP1-      -------------
A0A2K5NJZ2_PMAIP1-      -------------
A0A0D9S003_PMAIP1-      -------------
A0A2K5VPX2_PMAIP1-      -------------
A0A2K6BV43_PMAIP1-      -------------
A0A2K5ZWH1_PMAIP1-      -------------
A0A096MPU8_PMAIP1-      -------------
A0A2K5JY17_PMAIP1-      -------------
A0A2K6KJF1_PMAIP1-      -------------
A0A2K6NC45_PMAIP1-      -------------
A0A2K6S6C4_PMAIP1-      -------------
A0A2I2YVQ5_PMAIP1-      -------------
A0A2R9AKC9_PMAIP1-      -------------
A0A2I3SX38_PMAIP1-      -------------
H2NWG2_PMAIP1-01        -------------
A0A2K5CFK7_PMAIP1-      -------------
F7GW45_PMAIP1-01        -------------
A0A2K5QQC6_PMAIP1-      -------------
A0A337SUX1_PMAIP1-      -------------
A0A3Q1NFP6_PMAIP1-      -------------
A0A452EST2_PMAIP1-      -------------
W5P738_PMAIP1-01        -------------
A0A3B5RFA9_PMAIP1-      -------------
A0A0P0HZF9_PMAIP1-      R------------
Q0GKC8_PMAIP1-01        R------------
Q9GL49_PMAIP1-01        -------------
F1SMU1_PMAIP1-01        -------------
A0A2I2YVQ5_PMAIP1-      MGALGNGRWNTSK
A0A2I3SX38_PMAIP1-      -------------
A0A2K5JY17_PMAIP1-      -------------
A0A2R9AKC9_PMAIP1-      -------------
A0A2K6KJF1_PMAIP1-      -------------
A0A2K6NC45_PMAIP1-      -------------
A0A096MPU8_PMAIP1-      -------------
A0A2K5ZWH1_PMAIP1-      -------------
A0A2K5VPX2_PMAIP1-      -------------
A0A2K6BV43_PMAIP1-      -------------
A0A286XF37_PMAIP1-      -------------
A0A1U7QLK6_PMAIP1-      -------------
Q9JM54_PMAIP1-01        -------------
Q5U777_PMAIP1-01        -------------
                                     

© 1998-2020Legal notice