Dataset for protein Noxa of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

73 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9GL49_PMAIP1-01        MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGS
A0A669QIC6_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
H2NWG2_PMAIP1-01        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-02        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A286XF37_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-01        --------------------------------------------------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A667HYB7_PMAIP1-      --------------------------------------------------
A0A671EYM5_PMAIP1-      --------------------------------------------------
A0A4W4H0G9_PMAIP1-      --------------------------------------------------
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------------------
Q0GKC8_PMAIP1-01        --------------------------------------------------
A0A803TSK5_PMAIP1-      --------------------------------------------------
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      --------------------------------------------------
A0A5F9C629_PMAIP1-      --------------------------------------------------
A0A2K6EM90_PMAIP1-      --------------------------------------------------
A0A670IXL8_PMAIP1-      --------------------------------------------------
G1P8F9_PMAIP1-01        --------------------------------------------------
Q9JM54_PMAIP1-03        --------------------------------------------------
A0A3Q2I0H2_PMAIP1-      --------------------------------------------------
G3T0P7_PMAIP1-01        --------------------------------------------------
A0A7N5JEA5_PMAIP1-      --------------------------------------------------
A0A452STA4_PMAIP1-      --------------------------------------------------
A0A2K5NJZ2_PMAIP1-      --------------------------------------------------
A0A0D9S003_PMAIP1-      --------------------------------------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K5ZWH1_PMAIP1-      --------------------------------------------------
A0A2K5JY17_PMAIP1-      --------------------------------------------------
A0A2K6KJF1_PMAIP1-      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6S6C4_PMAIP1-      --------------------------------------------------
A0A2I2YVQ5_PMAIP1-      --------------------------------------------------
Q13794_PMAIP1-01        --------------------------------------------------
A0A2R9AKC9_PMAIP1-      --------------------------------------------------
A0A2I3SX38_PMAIP1-      --------------------------------------------------
A0A2K5CFK7_PMAIP1-      --------------------------------------------------
A0A2K5QQC6_PMAIP1-      --------------------------------------------------
A0A337SUX1_PMAIP1-      --------------------------------------------------
A0A673UI19_PMAIP1-      --------------------------------------------------
A0A2Y9P485_PMAIP1-      --------------------------------------------------
A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A3Q1NFP6_PMAIP1-      --------------------------------------------------
A0A4W2CDL0_PMAIP1-      --------------------------------------------------
A0A452EST2_PMAIP1-      --------------------------------------------------
W5P738_PMAIP1-01        --------------------------------------------------
A0A803YIP1_PMAIP1-      --------------------------------------------------
A0A663N909_PMAIP1-      --------------------------------------------------
A0A1D5PAR2_PMAIP1-      --------------------------------------------------
Q9JM54_PMAIP1-02        --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
G1LIZ7_PMAIP1-01        --------------------------------------------------
A0A452TE71_PMAIP1-      --------------------------------------------------
A0A452J430_PMAIP1-      --------------------------------------------------
A0A493SWX7_PMAIP1-      --------------------------------------------------
A0A674JUE0_PMAIP1-      --------------------------------------------------
A0A7M4FB17_PMAIP1-      --------------------------------------------------
A0A663FH84_PMAIP1-      --------------------------------------------------
A0A670ZS96_PMAIP1-      --------------------------------------------------
                                                                          

Q9GL49_PMAIP1-01        FGPPPAAVRGNQPTSEAFGRSGCCFS-SSLPLAR-FCPTAPRAACYLQSQ
A0A669QIC6_PMAIP1-      -------------------MPGRTIR-KPAPPAA-PAGRERRREAGLNFF
A0A2I2YVQ5_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAGP-----AGT
A0A2I3SX38_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAGP-----AGT
H2NWG2_PMAIP1-01        -------------------MPGKKAR-KNAQPSP-ARAPAGA---GTAGT
A0A2I3HX97_PMAIP1-      -------------------SLG-EAR-RNAQPSP-APAPAGTDPLGTAGT
A0A2K5JY17_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAG---TDPLGP
A0A2K5NJZ2_PMAIP1-      -------------------MPGKKAR-KNAQPSP-MRAQAGQ--AGTAGT
A0A2K5ZWH1_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAGQ--AGTAGT
A0A2K5VPX2_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAGPGTAGTAGT
A0A2K6BV43_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAGP--AGTAGT
A0A2K6KJF1_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAGP--AGTAGT
A0A2K6NC45_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAGP--AGTAGT
Q13794_PMAIP1-02        -------------------MPGKKAR-KNAQPSP-ARAPAGP--AGTAGT
A0A2R9AKC9_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAGP-----AGT
A0A286XF37_PMAIP1-      -------------------MPGKVCK-SAQPNST-RAELEVECAAQLRRV
Q9JM54_PMAIP1-01        -------------------------M-PGRKARR-NAPVNPTRAELPPEF
A0A4X1TQ35_PMAIP1-      -------------TSEAFGRSGCCFS-SSLPLAR-FCPTAPRAACYLQSQ
F1SMU1_PMAIP1-01        -----ARAAAGAPTSEAFGRSGCCFS-SSLPLAR-FCPTAPRAACYLQSQ
A0A667HYB7_PMAIP1-      ---EESAGAGRRSDLRGARASLSSLV-ELGPAAP-VRPVPPR-ACSSRAA
A0A671EYM5_PMAIP1-      ------VGSCFSPEPEVLGYPLSAVS-SRLPSGP-ARPPGAQ-LASCRPQ
A0A4W4H0G9_PMAIP1-      ------------------KQAGTSPV-TPCQLIS-WLSDLFL--------
A0A3B5RFA9_PMAIP1-      -------------------LPAAAEL------------------------
A0A0P0HZF9_PMAIP1-      --------------------------------------MAKK--------
Q0GKC8_PMAIP1-01        --------------------------------------MAKK--------
A0A803TSK5_PMAIP1-      -------------------MPGLESH------------KSEV--------
A0A674HDV6_PMAIP1-      -------------------MPGRTLR-KTAPPAAPAA-------------
A0A5F8ATY0_PMAIP1-      -------------------MPSKNEK-TNLQPQP-TNQQMEL--------
A0A5F9C629_PMAIP1-      -------------------MPGKRAR-KRSQSSP-KRAPAEL--------
A0A2K6EM90_PMAIP1-      -------------------MPVKKAR-KNAQPSP-TRTRAEI--------
A0A670IXL8_PMAIP1-      -------------------MPSQRLE-LQLPPAP-ASTTNDS--------
G1P8F9_PMAIP1-01        -------------------MPGKKAR-KNAQPSP-TRAPAEA--------
Q9JM54_PMAIP1-03        -------------------MPGKSQKSRMRSPSP-TRVPADL--------
A0A3Q2I0H2_PMAIP1-      -------------------MPTRKAR-KSGQPSP-TRAPAEL--------
G3T0P7_PMAIP1-01        -------------------MPGKKAR-KSAQPGP-AGTPAGT--------
A0A7N5JEA5_PMAIP1-      -------------------MPGKKAR-KSAQASP-ARTPAEP--------
A0A452STA4_PMAIP1-      -------------------MPGKKAR-KSAQASP-ARTPAEP--------
A0A2K5NJZ2_PMAIP1-      -------------------MPGKKAR-KNAQPSP-MRAQAEL--------
A0A0D9S003_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAEL--------
A0A2K6BV43_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAEL--------
A0A2K5ZWH1_PMAIP1-      -------------------MPGKKAR-KNAQPSP-TRAQAEL--------
A0A2K5JY17_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAEL--------
A0A2K6KJF1_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAEL--------
A0A2K6NC45_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAQAEL--------
A0A2K6S6C4_PMAIP1-      -------------------MPGKKAR-KSAQPSP-ARAPADL--------
A0A2I2YVQ5_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAEL--------
Q13794_PMAIP1-01        -------------------MPGKKAR-KNAQPSP-ARAPAEL--------
A0A2R9AKC9_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAEL--------
A0A2I3SX38_PMAIP1-      -------------------MPGKKAR-KNAQPSP-ARAPAEL--------
A0A2K5CFK7_PMAIP1-      -------------------MPGKKAR-KSAQPSP-SRAPADL--------
A0A2K5QQC6_PMAIP1-      -------------------MPGKKAR-KSAQPSP-APAPADL--------
A0A337SUX1_PMAIP1-      -------------------MPGKRTR-KSAQPSP-ARAPAEP--------
A0A673UI19_PMAIP1-      -------------------MPGKKAR-KSAQPSP-ARAPAEP--------
A0A2Y9P485_PMAIP1-      -------------------MPGRRVR-KSAQQSP-TRAPADP--------
A0A2Y9TJ73_PMAIP1-      -------------------MPGRRAR-KSAQQSP-TRAPADP--------
A0A4W2CDL0_PMAIP1-      -------------------MPGRRAR-KSAQPSP-TRVPADP--------
A0A3Q1NFP6_PMAIP1-      -------------------MPGRRAR-KSAQPSP-TRVPADP--------
A0A4W2CDL0_PMAIP1-      -------------------MPGRRAR-KSAQPSP-TRVPADP--------
A0A452EST2_PMAIP1-      -------------------MPGRRAR-RSAQPSP-TRVPADP--------
W5P738_PMAIP1-01        -------------------MPGRRAR-RSAQPSP-TRVPADP--------
A0A803YIP1_PMAIP1-      -------------------LSGKDLV-RIKS--P-SPCACSA--------
A0A663N909_PMAIP1-      -------------------LPGHHHK-RRCGWLT-AVLVPSA--------
A0A1D5PAR2_PMAIP1-      ------------------MMPGRTIR-K-----P-APPAAPA--------
Q9JM54_PMAIP1-02        -------------------MPGRKAR-RNAPVNP---TRADL--------
A0A2I3HX97_PMAIP1-      --------------------KPGRAR-RNAQPSP-APAPAEL--------
G1LIZ7_PMAIP1-01        -------------------IGSLLSG-EPASPSP-SAAPPP---------
A0A452TE71_PMAIP1-      -------------------WGSLLSG-EPASPSP-SAAPPP---------
A0A452J430_PMAIP1-      -------------------MPGKTLR-KGAQQNP-ALPAQEA--------
A0A493SWX7_PMAIP1-      -------------------MPCRTLR-KPAQPSA----ERQA--------
A0A674JUE0_PMAIP1-      -------------------VRGTKFG-SRFEPPP----TQEA--------
A0A7M4FB17_PMAIP1-      -------------------QSGRDSD-TSASPAPAMLPEREA--------
A0A663FH84_PMAIP1-      -------------------MPGRTLR-KAAPPAAP--AGREV--------
A0A670ZS96_PMAIP1-      -------------------RGGKERQ-RTAASTE------EC--------
                                                                          

Q9GL49_PMAIP1-01        GARVRGLSSRS---FAA-KFRLLFAEMPGRRSR-RNTQTNPTRVALPPDP
A0A669QIC6_PMAIP1-      TGVDTGKKQAFPFFFSF--------------FFSTVFFPSPISLSGKDLV
A0A2I2YVQ5_PMAIP1-      ARDQAGFGIEMQLRFTR-----------GKKLLSSS----PLALPRGHEE
A0A2I3SX38_PMAIP1-      ARDQAGFGIGMQLRFTR-----------GKKLLSSSLSSWPLALPRGHEE
H2NWG2_PMAIP1-01        ARDQAGFGIGMQLRFTR-----------GKKLLSSS----PLALPRGHEE
A0A2I3HX97_PMAIP1-      ARNQAGFGIGMQLRFTR-----------GKKLLSSSLSSSPLALPRGHEE
A0A2K5JY17_PMAIP1-      AKTQAGRGRG------R-----------GKKLL-----SSPLALPRGHEE
A0A2K5NJZ2_PMAIP1-      ARDQAGFGIGMQLHFTR-----------GKELV----SSSPLALPRGREE
A0A2K5ZWH1_PMAIP1-      ARDQAGFGIGMQLHFTR-----------GKKLV----SSSPLALPRGHEE
A0A2K5VPX2_PMAIP1-      ARDQAGFGIGMQLHYTR-----------GKKLV----SSSPLVLPRGHEE
A0A2K6BV43_PMAIP1-      ARDQAGFGIGMQLHYTR-----------GKKLV----SSSPLVLPRGHEE
A0A2K6KJF1_PMAIP1-      ARDQAGLGIGMQLHFTR-----------GKKLL----SSSPLALPRGHEE
A0A2K6NC45_PMAIP1-      ARDQAGLGIGMQLHFTR-----------GKKLL----SSSPLALPRGHEE
Q13794_PMAIP1-02        ARDQAGFAIGMQLRFTR-----------GKKLLSSSLSSSPLALPRGHEE
A0A2R9AKC9_PMAIP1-      ARDQAGFGIGMQLRFTR-----------GKKLLSSS-SSSPLALPRGHEE
A0A286XF37_PMAIP1-      GDTLNSLGCTT-------EALEVLAEMAGKKAR-KSSEPDPARA--RAEL
Q9JM54_PMAIP1-01        AAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRV--PADL
A0A4X1TQ35_PMAIP1-      GARVRGLSSRS---FAA-KFRLLFAEMPGRRSR-RNTQTNPTRVALPPDP
F1SMU1_PMAIP1-01        GARVRGLSSRS---FAA-KFRLLFAEMPGRRSR-RNTQTNPTRVALPPDP
A0A667HYB7_PMAIP1-      APRCSGWGTENPGLLRH-GGRRPLAEMPGKRTR-KSAQPSPARA--PAEP
A0A671EYM5_PMAIP1-      GA-TQGWGTEFPGGLQQ-TSRRLLAEMPGKKAR-KNAQPSPTRA--PAEL
A0A4W4H0G9_PMAIP1-      ----------------------------------------------EQTV
A0A3B5RFA9_PMAIP1-      --------------------------------------------------
A0A0P0HZF9_PMAIP1-      ----------------------------------------------EKTA
Q0GKC8_PMAIP1-01        ----------------------------------------------EQTA
A0A803TSK5_PMAIP1-      ----------------------------------------------A---
A0A674HDV6_PMAIP1-      --------------------------------------------------
A0A5F8ATY0_PMAIP1-      ----------------------------------------------Q---
A0A5F9C629_PMAIP1-      ----------------------------------------------E---
A0A2K6EM90_PMAIP1-      ----------------------------------------------E---
A0A670IXL8_PMAIP1-      ----------------------------------------------E--A
G1P8F9_PMAIP1-01        ----------------------------------------------E---
Q9JM54_PMAIP1-03        ----------------------------------------------K---
A0A3Q2I0H2_PMAIP1-      ----------------------------------------------E---
G3T0P7_PMAIP1-01        ----------------------------------------------QQRD
A0A7N5JEA5_PMAIP1-      ----------------------------------------------E---
A0A452STA4_PMAIP1-      ----------------------------------------------E---
A0A2K5NJZ2_PMAIP1-      ----------------------------------------------E---
A0A0D9S003_PMAIP1-      ----------------------------------------------E---
A0A2K6BV43_PMAIP1-      ----------------------------------------------E---
A0A2K5ZWH1_PMAIP1-      ----------------------------------------------E---
A0A2K5JY17_PMAIP1-      ----------------------------------------------E---
A0A2K6KJF1_PMAIP1-      ----------------------------------------------E---
A0A2K6NC45_PMAIP1-      ----------------------------------------------E---
A0A2K6S6C4_PMAIP1-      ----------------------------------------------E---
A0A2I2YVQ5_PMAIP1-      ----------------------------------------------E---
Q13794_PMAIP1-01        ----------------------------------------------E---
A0A2R9AKC9_PMAIP1-      ----------------------------------------------E---
A0A2I3SX38_PMAIP1-      ----------------------------------------------E---
A0A2K5CFK7_PMAIP1-      ----------------------------------------------E---
A0A2K5QQC6_PMAIP1-      ----------------------------------------------E---
A0A337SUX1_PMAIP1-      ----------------------------------------------E---
A0A673UI19_PMAIP1-      ----------------------------------------------E---
A0A2Y9P485_PMAIP1-      ----------------------------------------------E---
A0A2Y9TJ73_PMAIP1-      ----------------------------------------------E---
A0A4W2CDL0_PMAIP1-      ----------------------------------------------E---
A0A3Q1NFP6_PMAIP1-      ----------------------------------------------E---
A0A4W2CDL0_PMAIP1-      ----------------------------------------------E---
A0A452EST2_PMAIP1-      ----------------------------------------------E---
W5P738_PMAIP1-01        ----------------------------------------------E---
A0A803YIP1_PMAIP1-      ----------------------------------------------ERDA
A0A663N909_PMAIP1-      ----------------------------------------------EREA
A0A1D5PAR2_PMAIP1-      ----------------------------------------------ERDA
Q9JM54_PMAIP1-02        ----------------------------------------------K---
A0A2I3HX97_PMAIP1-      ----------------------------------------------E---
G1LIZ7_PMAIP1-01        ----------------------------------------------E---
A0A452TE71_PMAIP1-      ----------------------------------------------E---
A0A452J430_PMAIP1-      ----------------------------------------------V---
A0A493SWX7_PMAIP1-      ----------------------------------------------V---
A0A674JUE0_PMAIP1-      ----------------------------------------------V---
A0A7M4FB17_PMAIP1-      ----------------------------------------------V---
A0A663FH84_PMAIP1-      ----------------------------------------------E---
A0A670ZS96_PMAIP1-      ----------------------------------------------S---
                                                                          

Q9GL49_PMAIP1-01        EVECAIQ--------------------------------------FRRIG
A0A669QIC6_PMAIP1-      RIKSPSPCACFAERDAVAECALE----------------------LRRIG
A0A2I2YVQ5_PMAIP1-      QVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLL
A0A2I3SX38_PMAIP1-      QVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLL
H2NWG2_PMAIP1-01        QVQIAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLL
A0A2I3HX97_PMAIP1-      QVQV---RTSLSRQK--GQTELPAETSESDIQTLLLRNLTASKTCMRGLL
A0A2K5JY17_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTATKTCMRGLQ
A0A2K5NJZ2_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTASNTCIRGLQ
A0A2K5ZWH1_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTASKTCIRGLQ
A0A2K5VPX2_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETSESDSQTLLLRNLTASKTCIRGLQ
A0A2K6BV43_PMAIP1-      QVQVARSRVCYSTQEIWRQTKLPAETSESDSQTLLLRNLTASKTCIRGLQ
A0A2K6KJF1_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLTASKTCIRGLQ
A0A2K6NC45_PMAIP1-      QVQVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLTASKTCIRGLQ
Q13794_PMAIP1-02        QVQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLL
A0A2R9AKC9_PMAIP1-      QAQVAGSRVCYSTQEIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLL
A0A286XF37_PMAIP1-      EVECAAQ--------------------------------------LRRIG
Q9JM54_PMAIP1-01        KDECA-Q--------------------------------------LRRIG
A0A4X1TQ35_PMAIP1-      EVECAIQ--------------------------------------FRRIG
F1SMU1_PMAIP1-01        EVECAIQ--------------------------------------FRRIG
A0A667HYB7_PMAIP1-      EVECAMQ--------------------------------------LRRFG
A0A671EYM5_PMAIP1-      EVECAIQ--------------------------------------FRRIG
A0A4W4H0G9_PMAIP1-      VSECACQ--------------------------------------LRRMG
A0A3B5RFA9_PMAIP1-      ---CARE--------------------------------------LRQVG
A0A0P0HZF9_PMAIP1-      VVECAQQ--------------------------------------LRTIG
Q0GKC8_PMAIP1-01        VVECAQQ--------------------------------------LRNIG
A0A803TSK5_PMAIP1-      -AECALQ--------------------------------------LRVIG
A0A674HDV6_PMAIP1-      -VECALE--------------------------------------LTRIG
A0A5F8ATY0_PMAIP1-      -IQFAKR--------------------------------------KRAFG
A0A5F9C629_PMAIP1-      -VECATQ--------------------------------------LRIIG
A0A2K6EM90_PMAIP1-      -EECALQ--------------------------------------LRRLG
A0A670IXL8_PMAIP1-      VRECALQ--------------------------------------LRRMG
G1P8F9_PMAIP1-01        -IECALQ--------------------------------------LRRIG
Q9JM54_PMAIP1-03        -DECA-Q--------------------------------------LRRIG
A0A3Q2I0H2_PMAIP1-      -AECAIQ--------------------------------------IRRIG
G3T0P7_PMAIP1-01        VVECAIQ--------------------------------------LRRIG
A0A7N5JEA5_PMAIP1-      -VECAIQ--------------------------------------LRRFG
A0A452STA4_PMAIP1-      -VECAIQ--------------------------------------LRRFG
A0A2K5NJZ2_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A0D9S003_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K6BV43_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K5ZWH1_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K5JY17_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K6KJF1_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K6NC45_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K6S6C4_PMAIP1-      -VECAIQ--------------------------------------LRRFG
A0A2I2YVQ5_PMAIP1-      -VECATQ--------------------------------------LRRFG
Q13794_PMAIP1-01        -VECATQ--------------------------------------LRRFG
A0A2R9AKC9_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2I3SX38_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K5CFK7_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A2K5QQC6_PMAIP1-      -VECATQ--------------------------------------LRRFG
A0A337SUX1_PMAIP1-      -VECAMQ--------------------------------------LRRFG
A0A673UI19_PMAIP1-      -VECAMQ--------------------------------------LRRIG
A0A2Y9P485_PMAIP1-      -VECAIQ--------------------------------------FRRIG
A0A2Y9TJ73_PMAIP1-      -VECAIQ--------------------------------------FRRIG
A0A4W2CDL0_PMAIP1-      -VECAIQ--------------------------------------LRRIG
A0A3Q1NFP6_PMAIP1-      -VECAIQ--------------------------------------LRRIG
A0A4W2CDL0_PMAIP1-      -VECAIQ--------------------------------------LRRIG
A0A452EST2_PMAIP1-      -VECAIQ--------------------------------------LRRIG
W5P738_PMAIP1-01        -VECAIQ--------------------------------------LRRIG
A0A803YIP1_PMAIP1-      VAECALE--------------------------------------LRKIG
A0A663N909_PMAIP1-      VAECALQ--------------------------------------LRRIG
A0A1D5PAR2_PMAIP1-      VAECALE--------------------------------------LRRIG
Q9JM54_PMAIP1-02        -DECA-Q--------------------------------------LRRIG
A0A2I3HX97_PMAIP1-      -VECATQ--------------------------------------LRRFG
G1LIZ7_PMAIP1-01        -VECAIQ--------------------------------------LRRFG
A0A452TE71_PMAIP1-      -VECAIQ--------------------------------------LRRFG
A0A452J430_PMAIP1-      -TQCSLQ--------------------------------------LRKIG
A0A493SWX7_PMAIP1-      -AECALE--------------------------------------LRRIG
A0A674JUE0_PMAIP1-      -MQCSLQ--------------------------------------LRKIG
A0A7M4FB17_PMAIP1-      -RECALQ--------------------------------------LRRIG
A0A663FH84_PMAIP1-      -AQCALQ--------------------------------------LRRIG
A0A670ZS96_PMAIP1-      -VMIALQ--------------------------------------LRRIG
                                                                        . 

Q9GL49_PMAIP1-01        DKLNFRQKLLNLIAKL-----FRLGT------------------------
A0A669QIC6_PMAIP1-      DKADLRQKVLNLIAKL-----FCPKT------------------------
A0A2I2YVQ5_PMAIP1-      QKSFLRRCTFHQFEER-----LHCNWEECEGAFMGALGNGRWNTSK----
A0A2I3SX38_PMAIP1-      QKSFLRRCTFHQFEER-----LHCNW------------------------
H2NWG2_PMAIP1-01        QKSFLRRCTFHQFEER-----LHCHW------------------------
A0A2I3HX97_PMAIP1-      QKSFLRRRTFHQFEER-----LHCN-------------------------
A0A2K5JY17_PMAIP1-      KRIFLRRCTFHQFEAR-----LHCN-------------------------
A0A2K5NJZ2_PMAIP1-      KRLFLRRCTLHQFEER-----LHCNW------------------------
A0A2K5ZWH1_PMAIP1-      KRLFLRRCILHKFEER-----LHCNW------------------------
A0A2K5VPX2_PMAIP1-      KRLFLRRCTLHQFEER-----LHCNW------------------------
A0A2K6BV43_PMAIP1-      KRLFLRRCTLHQFEER-----LHCNW------------------------
A0A2K6KJF1_PMAIP1-      TRIFLRRCTFHQFEER-----LHCNW------------------------
A0A2K6NC45_PMAIP1-      TRIFLRRCTFHQFEER-----LHCNW------------------------
Q13794_PMAIP1-02        QKSFLRRCTFHQFEER-----LHCN-------------------------
A0A2R9AKC9_PMAIP1-      QKSFLRRCTFHQFEER-----LHCNW------------------------
A0A286XF37_PMAIP1-      DKLNFQQKLMYLISKL-----ISLVT------------------------
Q9JM54_PMAIP1-01        DKVNLRQKLLNLISKL-----FNLVT------------------------
A0A4X1TQ35_PMAIP1-      DKLNFRQKLLNLIAKL-----FRLGT------------------------
F1SMU1_PMAIP1-01        DKLNFRQKLLNLIAKL-----FRLGT------------------------
A0A667HYB7_PMAIP1-      DKLNFRQKLMNLISKL-----FRSGT------------------------
A0A671EYM5_PMAIP1-      DKLSFRQKLLNLISKL-----FRSGT------------------------
A0A4W4H0G9_PMAIP1-      DLINWKYLLLHLIADARTRLGICSGNDVVALCM-----------------
A0A3B5RFA9_PMAIP1-      DKLYWRYKLLEMLLKN-----YETLNKIK---------------------
A0A0P0HZF9_PMAIP1-      DLFDWKYKLLEIIIAL-----QKAQTDGKR--------------------
Q0GKC8_PMAIP1-01        DLLNWKYKLLELIVTL-----QKIQMEGKR--------------------
A0A803TSK5_PMAIP1-      DKWNLRQRILNMISKI-----FCPGRGE----------------------
A0A674HDV6_PMAIP1-      DRWDLRQRLLNLLAKL-----FCPGTWAARGHGERNGGGPWLCGFGRRGS
A0A5F8ATY0_PMAIP1-      GRLNRRDKSLALSPRL-----ECSGP------------------------
A0A5F9C629_PMAIP1-      DKLDLRRKLLNLISKF-----FNFVP------------------------
A0A2K6EM90_PMAIP1-      DKLHFQQKLLNLIAKL-----FRSGT------------------------
A0A670IXL8_PMAIP1-      DKWNLRQKILNLISKL-----FCPET------------------------
G1P8F9_PMAIP1-01        DKLSFLQKLLNLMYKL-----FGSGT------------------------
Q9JM54_PMAIP1-03        DKVNLRQKLLNLISKL-----FNLVT------------------------
A0A3Q2I0H2_PMAIP1-      DKLNFRQKLLNLIAKL-----FRSGT------------------------
G3T0P7_PMAIP1-01        DKINFRQKLLNVICKL-----FCSGT------------------------
A0A7N5JEA5_PMAIP1-      DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A452STA4_PMAIP1-      DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A2K5NJZ2_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A0D9S003_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K6BV43_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K5ZWH1_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K5JY17_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K6KJF1_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K6NC45_PMAIP1-      DKLNFRQKLLNLIAKL-----FCSGT------------------------
A0A2K6S6C4_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A2I2YVQ5_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
Q13794_PMAIP1-01        DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A2R9AKC9_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A2I3SX38_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A2K5CFK7_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A2K5QQC6_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
A0A337SUX1_PMAIP1-      DKLNFRQKLMNLISKL-----FRSGT------------------------
A0A673UI19_PMAIP1-      DKLNFRQKLMNLIAKL-----FRSGT------------------------
A0A2Y9P485_PMAIP1-      DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A2Y9TJ73_PMAIP1-      DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A4W2CDL0_PMAIP1-      DKLNFRQKLVNLISKL-----LRSGT------------------------
A0A3Q1NFP6_PMAIP1-      DKLNFRQKLVNLISKL-----LRSGT------------------------
A0A4W2CDL0_PMAIP1-      DKLNFRQKLVNLISKL-----LRSGT------------------------
A0A452EST2_PMAIP1-      DKLNFRQKLVNLIAKL-----LRSGT------------------------
W5P738_PMAIP1-01        DKLNFRQKLVNLIAKL-----LRSGT------------------------
A0A803YIP1_PMAIP1-      DKADLQQKVLNLIAKL-----FCPKKPRPRC-------------------
A0A663N909_PMAIP1-      DKWDLRQKILNLLTKL-----FCPET------------------------
A0A1D5PAR2_PMAIP1-      DKADLQQKVLNLITKL-----FCPKT------------------------
Q9JM54_PMAIP1-02        DKVNLRQKLLNLISKL-----FNLVT------------------------
A0A2I3HX97_PMAIP1-      DKLNFRQKLLNLISKL-----FCSGT------------------------
G1LIZ7_PMAIP1-01        DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A452TE71_PMAIP1-      DKLNFRQKLLNLISKL-----FRSGT------------------------
A0A452J430_PMAIP1-      DICNLQQKILNVITKL-----FCPGT------------------------
A0A493SWX7_PMAIP1-      DKADFRQRILNLITKL-----FCPKT------------------------
A0A674JUE0_PMAIP1-      DICNLQQKILNVITKL-----FCPGT------------------------
A0A7M4FB17_PMAIP1-      DQCHLHQKILGLIAKL-----FRPGT------------------------
A0A663FH84_PMAIP1-      DKWDLRQKILNLLTKL-----FFPET------------------------
A0A670ZS96_PMAIP1-      DKWNLRQRILNLFSKL-----FCPGT------------------------
                                 .                                        

Q9GL49_PMAIP1-01        -----
A0A669QIC6_PMAIP1-      -----
A0A2I2YVQ5_PMAIP1-      -----
A0A2I3SX38_PMAIP1-      -----
H2NWG2_PMAIP1-01        -----
A0A2I3HX97_PMAIP1-      -----
A0A2K5JY17_PMAIP1-      -----
A0A2K5NJZ2_PMAIP1-      -----
A0A2K5ZWH1_PMAIP1-      -----
A0A2K5VPX2_PMAIP1-      -----
A0A2K6BV43_PMAIP1-      -----
A0A2K6KJF1_PMAIP1-      -----
A0A2K6NC45_PMAIP1-      -----
Q13794_PMAIP1-02        -----
A0A2R9AKC9_PMAIP1-      -----
A0A286XF37_PMAIP1-      -----
Q9JM54_PMAIP1-01        -----
A0A4X1TQ35_PMAIP1-      -----
F1SMU1_PMAIP1-01        -----
A0A667HYB7_PMAIP1-      -----
A0A671EYM5_PMAIP1-      -----
A0A4W4H0G9_PMAIP1-      -----
A0A3B5RFA9_PMAIP1-      -----
A0A0P0HZF9_PMAIP1-      -----
Q0GKC8_PMAIP1-01        -----
A0A803TSK5_PMAIP1-      -----
A0A674HDV6_PMAIP1-      TDTGR
A0A5F8ATY0_PMAIP1-      -----
A0A5F9C629_PMAIP1-      -----
A0A2K6EM90_PMAIP1-      -----
A0A670IXL8_PMAIP1-      -----
G1P8F9_PMAIP1-01        -----
Q9JM54_PMAIP1-03        -----
A0A3Q2I0H2_PMAIP1-      -----
G3T0P7_PMAIP1-01        -----
A0A7N5JEA5_PMAIP1-      -----
A0A452STA4_PMAIP1-      -----
A0A2K5NJZ2_PMAIP1-      -----
A0A0D9S003_PMAIP1-      -----
A0A2K6BV43_PMAIP1-      -----
A0A2K5ZWH1_PMAIP1-      -----
A0A2K5JY17_PMAIP1-      -----
A0A2K6KJF1_PMAIP1-      -----
A0A2K6NC45_PMAIP1-      -----
A0A2K6S6C4_PMAIP1-      -----
A0A2I2YVQ5_PMAIP1-      -----
Q13794_PMAIP1-01        -----
A0A2R9AKC9_PMAIP1-      -----
A0A2I3SX38_PMAIP1-      -----
A0A2K5CFK7_PMAIP1-      -----
A0A2K5QQC6_PMAIP1-      -----
A0A337SUX1_PMAIP1-      -----
A0A673UI19_PMAIP1-      -----
A0A2Y9P485_PMAIP1-      -----
A0A2Y9TJ73_PMAIP1-      -----
A0A4W2CDL0_PMAIP1-      -----
A0A3Q1NFP6_PMAIP1-      -----
A0A4W2CDL0_PMAIP1-      -----
A0A452EST2_PMAIP1-      -----
W5P738_PMAIP1-01        -----
A0A803YIP1_PMAIP1-      -----
A0A663N909_PMAIP1-      -----
A0A1D5PAR2_PMAIP1-      -----
Q9JM54_PMAIP1-02        -----
A0A2I3HX97_PMAIP1-      -----
G1LIZ7_PMAIP1-01        -----
A0A452TE71_PMAIP1-      -----
A0A452J430_PMAIP1-      -----
A0A493SWX7_PMAIP1-      -----
A0A674JUE0_PMAIP1-      -----
A0A7M4FB17_PMAIP1-      -----
A0A663FH84_PMAIP1-      -----
A0A670ZS96_PMAIP1-      -----
                             

© 1998-2022Legal notice