Dataset for protein Noxa of organism all

[Download (right click)] [Alignment] [Repertoires]

73 sequence(s)

>gnl|bcl2dbpro|A0A7N5JEA5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTPAEPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=53 residues).
IGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A493SWX7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anas platyrhynchos platyrhynchos GN=PMAIP1 (length=51 residues).
MPCRTLRKPAQPSAERQAVAECALELRRIGDKADFRQRILNLITKLFCPKT
>gnl|bcl2dbpro|A0A803TSK5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anolis carolinensis GN=PMAIP1 (length=46 residues).
MPGLESHKSEVAAECALQLRVIGDKWNLRQRILNMISKIFCPGRGE
>gnl|bcl2dbpro|A0A2K5CFK7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Aotus nancymaae GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPSRAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A663FH84_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Aquila chrysaetos chrysaetos GN=PMAIP1 (length=53 residues).
MPGRTLRKAAPPAAPAGREVEAQCALQLRRIGDKWDLRQKILNLLTKLFFPET
>gnl|bcl2dbpro|A0A663N909_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Athene cunicularia GN=PMAIP1 (length=58 residues).
LPGHHHKRRCGWLTAVLVPSAEREAVAECALQLRRIGDKWDLRQKILNLLTKLFCPET
>gnl|bcl2dbpro|A0A4W2CDL0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos indicus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A3Q1NFP6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos taurus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A4W2CDL0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Bos indicus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLISKLLRSGT
>gnl|bcl2dbpro|A0A452EST2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Capra hircus GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A286XF37_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cavia porcellus GN=PMAIP1 (length=102 residues).
MPGKVCKSAQPNSTRAELEVECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKARKSSEPDPARARAELEVECAAQLRRI
GDKLNFQQKLMYLISKLISLVT
>gnl|bcl2dbpro|A0A2K5QQC6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cebus imitator GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPAPAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2K5NJZ2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cercocebus atys GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPMRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5NJZ2_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cercocebus atys GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPMRAQAGQAGTAGTARDQAGFGIGMQLHFTRGKELVSSSPLALPRGREEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASNTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A0D9S003_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5JY17_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=124 residues).
MPGKKARKNAQPSPARAQAGTDPLGPAKTQAGRGRGRGKKLLSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAET
SESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEARLHCN
>gnl|bcl2dbpro|A0A2K5JY17_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A7M4FB17_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Crocodylus porosus GN=PMAIP1 (length=55 residues).
QSGRDSDTSASPAPAMLPEREAVRECALQLRRIGDQCHLHQKILGLIAKLFRPGT
>gnl|bcl2dbpro|A0A0P0HZF9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ctenopharyngodon idella GN=PMAIP1 (length=45 residues).
MAKKEKTAVVECAQQLRTIGDLFDWKYKLLEIIIALQKAQTDGKR
>gnl|bcl2dbpro|Q0GKC8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Danio rerio GN=PMAIP1 (length=45 residues).
MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
>gnl|bcl2dbpro|A0A2Y9P485_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Delphinapterus leucas GN=PMAIP1 (length=54 residues).
MPGRRVRKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A4W4H0G9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Electrophorus electricus GN=PMAIP1 (length=71 residues).
KQAGTSPVTPCQLISWLSDLFLEQTVVSECACQLRRMGDLINWKYLLLHLIADARTRLGICSGNDVVALCM
>gnl|bcl2dbpro|A0A3Q2I0H2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Equus caballus GN=PMAIP1 (length=54 residues).
MPTRKARKSGQPSPTRAPAELEAECAIQIRRIGDKLNFRQKLLNLIAKLFRSGT
>gnl|bcl2dbpro|A0A337SUX1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Felis catus GN=PMAIP1 (length=54 residues).
MPGKRTRKSAQPSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
>gnl|bcl2dbpro|A0A1D5PAR2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gallus gallus GN=PMAIP1 (length=54 residues).
MMPGRTIRKPAPPAAPAERDAVAECALELRRIGDKADLQQKVLNLITKLFCPKT
>gnl|bcl2dbpro|A0A452J430_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gopherus agassizii GN=PMAIP1 (length=54 residues).
MPGKTLRKGAQQNPALPAQEAVTQCSLQLRKIGDICNLQQKILNVITKLFCPGT
>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=150 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIEMQLRFTRGKKLLSSSPLALPRGHEEQVQVAGSRVCYSTQEIWRQTE
LPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNWEECEGAFMGALGNGRWNTSK
>gnl|bcl2dbpro|A0A2I2YVQ5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Gorilla gorilla gorilla GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|Q13794_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Homo sapiens GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|Q13794_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Homo sapiens GN=PMAIP1 (length=136 residues).
MPGKKARKNAQPSPARAPAGPAGTAGTARDQAGFAIGMQLRFTRGKKLLSSSLSSSPLALPRGHEEQVQVAGSRVCYSTQ
EIWRQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCN
>gnl|bcl2dbpro|G3T0P7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Loxodonta africana GN=PMAIP1 (length=58 residues).
MPGKKARKSAQPGPAGTPAGTQQRDVVECAIQLRRIGDKINFRQKLLNVICKLFCSGT
>gnl|bcl2dbpro|A0A667HYB7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Lynx canadensis GN=PMAIP1 (length=123 residues).
EESAGAGRRSDLRGARASLSSLVELGPAAPVRPVPPRACSSRAAAPRCSGWGTENPGLLRHGGRRPLAEMPGKRTRKSAQ
PSPARAPAEPEVECAMQLRRFGDKLNFRQKLMNLISKLFRSGT
>gnl|bcl2dbpro|A0A2K5VPX2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca fascicularis GN=PMAIP1 (length=135 residues).
MPGKKARKNAQPSPTRAQAGPGTAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEI
WRQTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A5F8ATY0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca mulatta GN=PMAIP1 (length=54 residues).
MPSKNEKTNLQPQPTNQQMELQIQFAKRKRAFGGRLNRRDKSLALSPRLECSGP
>gnl|bcl2dbpro|A0A2K6BV43_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca nemestrina GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6BV43_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Macaca nemestrina GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGPAGTAGTARDQAGFGIGMQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWR
QTKLPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5ZWH1_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mandrillus leucophaeus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPTRAQAGQAGTAGTARDQAGFGIGMQLHFTRGKKLVSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRRCILHKFEERLHCNW
>gnl|bcl2dbpro|A0A803YIP1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Meleagris gallopavo GN=PMAIP1 (length=61 residues).
LSGKDLVRIKSPSPCACSAERDAVAECALELRKIGDKADLQQKVLNLIAKLFCPKKPRPRC
>gnl|bcl2dbpro|Q9JM54_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=103 residues).
MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRR
IGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|Q9JM54_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=51 residues).
MPGRKARRNAPVNPTRADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|Q9JM54_PMAIP1-03 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Mus musculus GN=PMAIP1 (length=54 residues).
MPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
>gnl|bcl2dbpro|G1P8F9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Myotis lucifugus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAPAEAEIECALQLRRIGDKLSFLQKLLNLMYKLFGSGT
>gnl|bcl2dbpro|A0A2I3HX97_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Nomascus leucogenys GN=PMAIP1 (length=53 residues).
KPGRARRNAQPSPAPAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2I3HX97_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Nomascus leucogenys GN=PMAIP1 (length=132 residues).
SLGEARRNAQPSPAPAPAGTDPLGTAGTARNQAGFGIGMQLRFTRGKKLLSSSLSSSPLALPRGHEEQVQVRTSLSRQKG
QTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRRTFHQFEERLHCN
>gnl|bcl2dbpro|A0A5F9C629_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Oryctolagus cuniculus GN=PMAIP1 (length=54 residues).
MPGKRARKRSQSSPKRAPAELEVECATQLRIIGDKLDLRRKLLNLISKFFNFVP
>gnl|bcl2dbpro|W5P738_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ovis aries GN=PMAIP1 (length=54 residues).
MPGRRARRSAQPSPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKLLRSGT
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSSSSPLALPRGHEEQAQVAGSRVCYSTQEIWR
QTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2R9AKC9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan paniscus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2I3SX38_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan troglodytes GN=PMAIP1 (length=134 residues).
MPGKKARKNAQPSPARAPAGPAGTARDQAGFGIGMQLRFTRGKKLLSSSLSSWPLALPRGHEEQVQVAGSRVCYSTQEIW
RQTELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2I3SX38_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pan troglodytes GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A669QIC6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Phasianus colchicus GN=PMAIP1 (length=114 residues).
MPGRTIRKPAPPAAPAGRERRREAGLNFFTGVDTGKKQAFPFFFSFFFSTVFFPSPISLSGKDLVRIKSPSPCACFAERD
AVAECALELRRIGDKADLRQKVLNLIAKLFCPKT
>gnl|bcl2dbpro|A0A2Y9TJ73_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Physeter macrocephalus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A670IXL8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Podarcis muralis GN=PMAIP1 (length=56 residues).
MPSQRLELQLPPAPASTTNDSEAVRECALQLRRMGDKWNLRQKILNLISKLFCPET
>gnl|bcl2dbpro|H2NWG2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pongo abelii GN=PMAIP1 (length=132 residues).
MPGKKARKNAQPSPARAPAGAGTAGTARDQAGFGIGMQLRFTRGKKLLSSSPLALPRGHEEQVQIAGSRVCYSTQEIWRQ
TELPAETSESDIQTLLLRNLTASKTCMRGLLQKSFLRRCTFHQFEERLHCHW
>gnl|bcl2dbpro|A0A2K6EM90_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Propithecus coquereli GN=PMAIP1 (length=54 residues).
MPVKKARKNAQPSPTRTRAEIEEECALQLRRLGDKLHFQQKLLNLIAKLFRSGT
>gnl|bcl2dbpro|A0A670ZS96_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pseudonaja textilis GN=PMAIP1 (length=49 residues).
RGGKERQRTAASTEECSVMIALQLRRIGDKWNLRQRILNLFSKLFCPGT
>gnl|bcl2dbpro|A0A671EYM5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=PMAIP1 (length=119 residues).
VGSCFSPEPEVLGYPLSAVSSRLPSGPARPPGAQLASCRPQGATQGWGTEFPGGLQQTSRRLLAEMPGKKARKNAQPSPT
RAPAELEVECAIQFRRIGDKLSFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A2K6KJF1_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6KJF1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus bieti GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6S6C4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECAIQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A673UI19_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Suricata suricatta GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPAEPEVECAMQLRRIGDKLNFRQKLMNLIAKLFRSGT
>gnl|bcl2dbpro|A0A4X1TQ35_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=113 residues).
TSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDP
EVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|F1SMU1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=121 residues).
ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPT
RVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|Q9GL49_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=176 residues).
MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSSSLP
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
RQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|A0A674HDV6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Taeniopygia guttata GN=PMAIP1 (length=78 residues).
MPGRTLRKTAPPAAPAAVECALELTRIGDRWDLRQRLLNLLAKLFCPGTWAARGHGERNGGGPWLCGFGRRGSTDTGR
>gnl|bcl2dbpro|A0A674JUE0_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Terrapene carolina triunguis GN=PMAIP1 (length=51 residues).
VRGTKFGSRFEPPPTQEAVMQCSLQLRKIGDICNLQQKILNVITKLFCPGT
>gnl|bcl2dbpro|A0A452STA4_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ursus americanus GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTPAEPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A452TE71_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ursus maritimus GN=PMAIP1 (length=53 residues).
WGSLLSGEPASPSPSAAPPPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A3B5RFA9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Xiphophorus maculatus GN=PMAIP1 (length=40 residues).
LPAAAELCARELRQVGDKLYWRYKLLEMLLKNYETLNKIK
© 1998-2022Legal notice