Dataset for protein Bik of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgmekstvasgllggrmgqscqdpgsytqiqtldsststvwtptvttsnwstangtiwaqwnstvvrpprwsvtssktrq
                              mp acmsmrtirnnqsppgvgp lckgsrhtehcgtqvlgtrrrprgghk
                                    nlgpdgllnalac ek gadag  eaeafrl acllglg faag
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------MSevrplsrdilmetllyeqll--ePlt
rksrprgfakrgrrvysgrrrwssastplwtstsvsssgsapwavtspsree--gaglia-nlflssfpqdh--geg-ev
lerpkglrsglrpnqpmslwtsgpvprttvsrsrsaqtymvwsvswpvvsgdfyht--v-s-vi-kav-h--vp  qapl
 agiha mreaqihgeklisprfmslnrsppkrqpwpqpiltkspvlsrl   hqskrm trt-q---hfqrfv  d --
             aaaekaqnpegnkgmflggphcpflicirgrnshrpk    --  - qh-wad p cnppm  - aa
                a  maldalddgagefhg  eddaeiammlfnng    tg  g m pv y   -   a  s vi
                     fa   a   ceaa  a    g lliedh     ae  c i h  p   d      h gf
                                           hgfacd      d                        
                                            ee aa                               
                                            a                                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                 :. .** *.*:*:      .                         .:
me-vlgvtdp--eedldpmedfdplecmegsdmvAlRLAcIGDEMdvslraPrlaqLpgvAmhsLglayiydq--girgv
lse-ps----vgmt---eyy--gsspnsndpnqlvmq  f a q elrwmsrqvgessemtvyrpaftfnqt-tddlwdi
adgt--mkeslw--evv-v-np-lm-dvdnrhd  p   y      rc--llhrvwpyripip ysv-lsrsrmevvt  
--vav gspg evgspss-r vn--r-lqs sa      s      ghfqm kiyt fdrlt   cas-tlv p rrq  
vgdqg lvrn  icqim ph lsfgqyift  s                l-  f   awl l    -pv-cn    gg  
ta    imq   a   t fg tpt gmc    y                 v               i   ha    f   
       lg       l e   ei  l     l                 d                             
       a              a         e                                               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:  .      :. :..     *                                                          
lrSf---mdgftnLrEnimrfWrs--ltprsw----------Vspe---------------------qvlllllllllll
fgglglhirslatfksdv-si sfgrpnfgnrgldlevslrftcrdfhdldspscmcsplepwsscppgrgavfsmva-v
 trv   lgv vs qdywww- gv  fsssaq     p  palqln                     sdprq-sp--pv-
 i   vvi  e prv-l ap  aal dc          hpgk                     wave-apavs-wa
       tsa  d    magv  c   wr p            dha                     vws-vcgdspvpw
       sq         i a  a      t             cr                     rt-swq vpeghs
       al                     f              h                     lrwpr  cha  q
        e                                    s                     apccp   f    
        a                                    q                      mh m        
                                             l                      l  e        

       330       340       350       360       370         
....:....|....:....|....:....|....:....|....:....|....:....
                                                           
llllsg---------------glhlllk-------------------------------
vamfgwacfthsssclfpgplawr-qq-pvqslpsshccfthsssclfpgplglrwlay
fpvwac               -fyw--qgphdhleqfa                     
--tv-s               w--isps hgc                           
ggss r               tvphrny                               
scpr h               s dgchr                               
m aq f               r aaaa                                
                     p                                     
                                                           
                                                           
© 1998-2022Legal notice