Dataset for protein Bik of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
metpecapvsgagktathmtkrvrrtagkrrtypsptgrlvsptvsstsytpvylslvgvwgpsqqvgrwgpgpqrssvp
                  er qrcmpqagvqhwnkns ptppgsrpnsiq  iqh al lreaapgac raac gfgpgs
                        ha  a eavd  r   c eppagafl                           ga 
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------Msevrplsrdilmetllyeqll--ePltme-vlgvtdp-
rsvwssvgprpegttplgwvadsaiiaatawsseearsrge--gaglias-lflksfphdh--geg-pvlsg----se-v
kplrlrgs  aad               m aaaaa aa e fyq---v--nt-i-a--c--fp  daela-etpsg--sm
aail  a                                   h-tksmttrvw-d-vhfqrvv  q ---avavpmkpgl
                                           tg r- qh-vqy p -nppm  - vatgdqg ivrn 
                                           he  g m p as   q  ma  s rpvd lf lmq  
                                           ad  c i h  p   d      h gi       lg  
                                                                   af       a   
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      :. .*. *.*:*:              . :               . .      .. :
-eedldpmedfdplecmegsdalAlrLAcIgDeMdvslraprlaqLsevamhslglafiydqtddirdvlrsfmdgftnl
g------v----smpdlddrnmvvmq vf a q elrwmsrqvveppgmtiyrpafty---sqtgvwgifsglirslatf
wvtvvte-rnpnls--vnnphq  pw  y      rcpqlyhigw ydipv  --v-lslnrr-rlg svgrvvvvvvs 
emgspssyyevs--rysqs ss      s      qhflrlts r l-r t   c-svvctnme -t   tlitsi  h 
 icqmv pt wptgqnift  d                 d kr   fw  s    ip tq gpv  q     hlqa  e 
 a eil lh tgi gmc    y                    f    r       a      hm  l      sl   d 
       fg lef dl     l                                        fa         ag     
       e   a         e                                                    e     
                                                                          a     
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.      *                                                                        
rEnimrfWrs--lnpgsw----------vsre------------------------------qvllalllllalll----
ksdv-sl sfgrptsrargldlevslrf-cpkfhdldspscmcsplepwsscpvghslagchpaprq-fpmvl---hsss
qdywv-- gv  fsr-dq     p  pat-ld                              -dvg-v-av-pvvf    
waprwwi ap  aafsp-          lqga                              s-sevcs-sp-wag    
  hmaga  c   -- nc          hp-r                              wpwalqps-fvpwv    
    i    a   wl -            dh-                              rwr-wm dpegcst    
             i  t              s                              ltqssa vfa  fs    
                l              q                               rcqr   a    m    
                f              l                               m-pp             
                               h                               lhcm             
                               g                               g  e             

       330       340       350       360     
....:....|....:....|....:....|....:....|....:
                                             
allsg--glhlllk-------------------------------
lmfgcplawy-q-qpvqslpsshccfthsssclfpgplglrwlay
p----  -frw-q-gphdhleqfa                     
-vwaw  w--isps hgc                           
ctvps  tvqgrny                               
gsrcr  s pachr                               
 pq h  r d aa                                
 a     p a                                   
                                             
                                             
                                             
© 1998-2020Legal notice