Dataset for protein Bik of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

34 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2LHE3_BIK-02      ------------------MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSY
F7FUT7_BIK-02          METPECAPVSGAGKTATHETKQVCRTAGGREAVNKPTGRTCSGSVANAIQ
F7FUT7_BIK-01          ------------------------MPQGAVRHYPSPRGRLPPPTPPGTFL
I3LVX0_BIK-01          --------------------------------------------------
G1TZR9_BIK-01          --------------------------------------------------
A0A2K5QXZ1_BIK-01      --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
Q925D2_BIK-01          --------------------------------------------------
A0A1S3FUQ7_BIK-01      --------------------------------------------------
H0XAE7_BIK-01          --------------------------------------------------
A0A2K6FM79_BIK-01      --------------------------------------------------
H0W025_BIK-01          --------------------------------------------------
A0A2K5CLG5_BIK-01      --------------------------------------------------
A0A2K6TBD7_BIK-01      --------------------------------------------------
H2P4N6_BIK-01          --------------------------------------------------
G1S1X2_BIK-01          --------------------------------------------------
G3QCT2_BIK-01          --------------------------------------------------
A0A2R8ZXD2_BIK-01      --------------------------------------------------
H2QLU7_BIK-01          --------------------------------------------------
A0A2K6MCW0_BIK-01      --------------------------------------------------
A0A2K6QK74_BIK-01      --------------------------------------------------
A0A0D9QZY8_BIK-01      --------------------------------------------------
A0A2K5VW94_BIK-01      --------------------------------------------------
A0A2K6DBJ4_BIK-01      --------------------------------------------------
A0A2K5J4Q7_BIK-01      --------------------------------------------------
A0A096NKG5_BIK-01      --------------------------------------------------
A0A2K5LDM6_BIK-01      --------------------------------------------------
A0A2K5XSA1_BIK-01      --------------------------------------------------
W5QCU2_BIK-01          --------------------------------------------------
A0A3Q2LHE3_BIK-01      --------------------------------------------------
A0A452QUG1_BIK-01      --------------------------------------------------
A0A452V3L2_BIK-01      --------------------------------------------------
                                                                         

A0A3Q2LHE3_BIK-02      ---------------------------SVPKAVWSSVG------------
F7FUT7_BIK-02          TPVQHSALGVREAAPGAGRRGAGPGRGGASRSIRSRAGPRAADTTPLGWV
F7FUT7_BIK-01          --IYLSLVGLWGPSQQVCRWAPCPQFSPGPAPLLLSGSPRPEG-------
I3LVX0_BIK-01          --------------------------------------------------
G1TZR9_BIK-01          --------------------------------------------------
A0A2K5QXZ1_BIK-01      --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
Q925D2_BIK-01          --------------------------------------------------
A0A1S3FUQ7_BIK-01      --------------------------------------------------
H0XAE7_BIK-01          --------------------------------------------------
A0A2K6FM79_BIK-01      --------------------------------------------------
H0W025_BIK-01          --------------------------------------------------
A0A2K5CLG5_BIK-01      --------------------------------------------------
A0A2K6TBD7_BIK-01      --------------------------------------------------
H2P4N6_BIK-01          --------------------------------------------------
G1S1X2_BIK-01          --------------------------------------------------
G3QCT2_BIK-01          --------------------------------------------------
A0A2R8ZXD2_BIK-01      --------------------------------------------------
H2QLU7_BIK-01          --------------------------------------------------
A0A2K6MCW0_BIK-01      --------------------------------------------------
A0A2K6QK74_BIK-01      --------------------------------------------------
A0A0D9QZY8_BIK-01      --------------------------------------------------
A0A2K5VW94_BIK-01      --------------------------------------------------
A0A2K6DBJ4_BIK-01      --------------------------------------------------
A0A2K5J4Q7_BIK-01      --------------------------------------------------
A0A096NKG5_BIK-01      --------------------------------------------------
A0A2K5LDM6_BIK-01      --------------------------------------------------
A0A2K5XSA1_BIK-01      --------------------------------------------------
W5QCU2_BIK-01          --------------------------------------------------
A0A3Q2LHE3_BIK-01      --------------------------------------------------
A0A452QUG1_BIK-01      --------------------------------------------------
A0A452V3L2_BIK-01      --------------------------------------------------
                                                                         

A0A3Q2LHE3_BIK-02      -------------------EEMSQVGPVSRDLFLDAFLHER----SPEAL
F7FUT7_BIK-02          ADSAIIAATAAAAAAAAARGEMSEVRPLSSDIFMETLLCEQFV--DPLTM
F7FUT7_BIK-01          -------------------GEMSEVRPLSSDIFMETLLCEQFV--DPLTM
I3LVX0_BIK-01          --------------------------------------------------
G1TZR9_BIK-01          ---------------------MSEVRPGSRDLFQEALLDEQVP--EPLLT
A0A2K5QXZ1_BIK-01      ---------------------MSEERPLSIDILMETLLCEQFM--DPLTM
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          ---------------------MSEARLMARDV-IKTVPHDQVP--QPPVA
O70337_BIK-01          ---------------------MSEARLMARDV-IKTVPHDQVP--QPPVA
Q925D2_BIK-01          ---------------------MSEARLMARDI-IKTLLHDQVP--QPAVV
A0A1S3FUQ7_BIK-01      ---------------------MSEAGSVTRDLFIKTLLYQQMP--GPRPA
H0XAE7_BIK-01          ---------------------MSAGRPVSMDHFMETFPFEQLL--EPLTM
A0A2K6FM79_BIK-01      ---------------------MSEVRPVSTDLLMETFPFEHLL--DPLIL
H0W025_BIK-01          ---------------------MSEAKPVARDPLMETPLFEPPP--GPLLA
A0A2K5CLG5_BIK-01      ---------------------MSEVRPLSSDILMETLLCEQFV--HPLTM
A0A2K6TBD7_BIK-01      ---------------------MSEDRPLSSDILMETLLCEQFV--DPLTM
H2P4N6_BIK-01          ---------------------MSEVRPISRDILMETLLYEQLL--EPPTM
G1S1X2_BIK-01          ---------------------MSEVRPISRDILMESLLYEQLL--EPPTM
G3QCT2_BIK-01          ---------------------MSEVRPLSRDILMETLLYEQLL--EPPTM
A0A2R8ZXD2_BIK-01      ---------------------MSEVRPLSRDILMETLLYEQLL--EPPTM
H2QLU7_BIK-01          ---------------------MSEVRPLSRDILMETLLYEQLL--EPPTM
A0A2K6MCW0_BIK-01      ---------------------MSGVRPVSRDILMETLLYEQLL--EPLTM
A0A2K6QK74_BIK-01      ---------------------MSGVRPVSRDILMETLLYEQLL--EPLTM
A0A0D9QZY8_BIK-01      ---------------------MSGVRPISRHILMESLLYEQLL--EPLTM
A0A2K5VW94_BIK-01      ---------------------MSGVRPISRDTLMETLLYEQLL--EPLTM
A0A2K6DBJ4_BIK-01      ---------------------MSGVRPISRDTLMETLLYEQLL--EPLTM
A0A2K5J4Q7_BIK-01      ---------------------MSGVRPISRDILMETLLYEQLL--EPLTM
A0A096NKG5_BIK-01      ---------------------MSGVRPISRDILMETLLYEQLL--EPLTM
A0A2K5LDM6_BIK-01      ---------------------MSGVRPISRDTWMETLLYEQLL--EPLTM
A0A2K5XSA1_BIK-01      ---------------------MSGVRPISRDTLMETLLYEQLL--EPLTM
W5QCU2_BIK-01          ---------------------MYQARPLSRNLFLYTFLQNH----GPGFL
A0A3Q2LHE3_BIK-01      ---------------------MSQVGPVSRDLFLDAFLHER----SPEAL
A0A452QUG1_BIK-01      ---------------------FHTTRRCAQRVVAPSLHHQHPAGEGAVLT
A0A452V3L2_BIK-01      --------MAWSSEEARSREEMSHTGPLSRNLFLSTFLQEH----GPEVL
                                                                         

A0A3Q2LHE3_BIK-02      E-VPG---------MTELTE--SSPDSDNRDSVAMRLAFIGDEMEVRWML
F7FUT7_BIK-02          E-VVGGSDP--EEDLDPVED--PLECMENSDALALQLACIADQMDVSLRA
F7FUT7_BIK-01          E-VVGGSDP--EEDLDPVED--PLECMENSDALALQLACIADQMDVSLRA
I3LVX0_BIK-01          -------------------------MVQGSHQVALRLACIGDEMDLCFQD
G1TZR9_BIK-01          AEVPGLTRPVEEGDLD------LMECLEGSNQVALRLAYIGDEMDLHPRR
A0A2K5QXZ1_BIK-01      EVVGGGSDP--EEDLDPVED--PLECMENSDALALQLACIADQMDVSLRA
O70337_BIK-04          --------------------------MFTRNQVALRLACIGDEMDLCLRS
O70337_BIK-02          SETPSMKE--------PVRDVDLMECVEGRNQVALRLACIGDEMDLCLRS
O70337_BIK-01          SETPSMKE--------PVRDVDLMECVEGRNQVALRLACIGDEMDLCLRS
Q925D2_BIK-01          SGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLACIGDEMDRCLRS
A0A1S3FUQ7_BIK-01      AGLFPITEPMGEEV------WDPMDCLEGSNQVALWLVCIGDEMDQRLRS
H0XAE7_BIK-01          E-VLGMTE------------PNPMECLEDSDQVALRLACIGDEMDLHLRS
A0A2K6FM79_BIK-01      E-VLSIMDN--------EENPDPSGCLEDSDEVALRLACIGDEMDLCLRS
H0W025_BIK-01          EGALGVTQPLWAEDLSPPGDTNLMECVEGSSLVALRLACIGDEMDLRLRS
A0A2K5CLG5_BIK-01      E-VVGGSDP--EEDLDPVED--PLECMENSDALVLQLACIADQMDVSLRA
A0A2K6TBD7_BIK-01      E-VVGGSDP--EEDPDSVED--PLECMENSDALALQLACIADQMDVSLRA
H2P4N6_BIK-01          E-VLGVTDS--EEDLDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRA
G1S1X2_BIK-01          E-VLGVTDP--EEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRA
G3QCT2_BIK-01          E-VLGVTDS--EEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRA
A0A2R8ZXD2_BIK-01      E-VLGVTES--EEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRA
H2QLU7_BIK-01          E-VLGVTDS--EEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRA
A0A2K6MCW0_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A2K6QK74_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A0D9QZY8_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A2K5VW94_BIK-01      E-VLGVTDP--EEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRA
A0A2K6DBJ4_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECIEDSDMLALRLACIGDEMDVSLRA
A0A2K5J4Q7_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A096NKG5_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A2K5LDM6_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
A0A2K5XSA1_BIK-01      E-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRA
W5QCU2_BIK-01          DDQGSGLPG--VTSILEFH--PISPYSDSPHYLAMQLASIADEMELRLLL
A0A3Q2LHE3_BIK-01      E-----VPG--MTELT-----ESSPDSDNRDSVAMRLAFIGDEMEVRWML
A0A452QUG1_BIK-01      G-----AGG--ICQ-------ATGPLCNNPDDVAMRLAFIGDEMEVRWML
A0A452V3L2_BIK-01      E-----VPG--MTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWML
                                                       :. .*. *.*:*:     

A0A3Q2LHE3_BIK-02      PHIAELPGVAVYS--LAFTYNQT-GLRGVFRSFMDGLTNLRENI-RFWSF
F7FUT7_BIK-02          RRLAQLYEVAMYSPGLAFVLDRT-DIGDVLSGVVDVFANFQEDIVRLWRS
F7FUT7_BIK-01          RRLAQLYEVAMYSPGLAFVLDRT-DIGDVLSGVVDVFANFQEDIVRLWRS
I3LVX0_BIK-01          LQLAQLPGMAMHSLALSY---SQARVTGVLRSLAQGLASLRENM-WFWRP
G1TZR9_BIK-01          YTSARLL-VPSYSLAFTYSQTGFTGVLGSVGLHLASLVELWSPWVRAWGA
A0A2K5QXZ1_BIK-01      RKLAQLYEVAMYSPGLAVTLDQT-DIRDVLGGIVDIFANFQEDVVRLWRS
O70337_BIK-04          PRLVQLPGIAIHRLAVTY---SRTGVRGIFRSLIRSLTNLRENIWS-WRV
O70337_BIK-02          PRLVQLPGIAIHRLAVTY---SRTGVRGIFRSLIRSLTNLRENIWS-WRV
O70337_BIK-01          PRLVQLPGIAIHRLAVTY---SRTGVRGIFRSLIRSLTNLRENIWS-WRV
Q925D2_BIK-01          PRLVQLPGIAMHRLAATY---SQTGVRGIFRSLIGSLTNLRENIWS-WRV
A0A1S3FUQ7_BIK-01      PRLAQLPGMAIHSLALTY---SQMGVWGVLRRLIRGVAHLRAHI-RAWRP
H0XAE7_BIK-01          PRLAQLSRMTMHSLG--LSYNQTDG-QGVLRSVISGFTNLRENIAGFWRS
A0A2K6FM79_BIK-01      PRLAWLPGMTMHSLGLALSCDQPVR-WGVLGSLSDGFANLREYVARLWRS
H0W025_BIK-01          PRLAQLPGRAVHSLAITY---SQMGLWGVLGRLTLSLASLRDNV---WAC
A0A2K5CLG5_BIK-01      RRLAQLYEVAMYSPGLAFILDRT-DIGDVLSGIVEVFANFQEDIVRLWRS
A0A2K6TBD7_BIK-01      RRLAQLYEVATYSPGLAFILDRT-DIRDVLSGVVDVFADFQEDIVRLWRS
H2P4N6_BIK-01          PRRAQLPEVAMHSLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSS
G1S1X2_BIK-01          PRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRS
G3QCT2_BIK-01          PRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRS
A0A2R8ZXD2_BIK-01      PRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRS
H2QLU7_BIK-01          PRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRS
A0A2K6MCW0_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRS
A0A2K6QK74_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRS
A0A0D9QZY8_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFIDGFTTLRENIMRFWRS
A0A2K5VW94_BIK-01      PRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRS
A0A2K6DBJ4_BIK-01      PRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRS
A0A2K5J4Q7_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRS
A0A096NKG5_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLRENIMRFWRS
A0A2K5LDM6_BIK-01      PRLAQLSEVAMHSLGLAFICDQTDDIRDVLRSFMDGFTTLRENIMRFWRS
A0A2K5XSA1_BIK-01      PRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFLDGFTTLRENIMRFWRS
W5QCU2_BIK-01          PQFVEPFWMPMYSLCFPY---SHVGLRDVLRSFMVAFTNLRENR-RLWSF
A0A3Q2LHE3_BIK-01      PHIAELPGVAVYSLAFTY---NQTGLRGVFRSFMDGLTNLRENI-RFWSF
A0A452QUG1_BIK-01      PRVGELPGMAMYSLAFTY---NQTGLRGVLRSLMDGLTNLRENI-RIWSF
A0A452V3L2_BIK-01      PRVGELPGMAMYSLAFTY---NQTGLRGVLRSLMDGLTNLRENI-RIWSF
                                . :               . .      .. :.      *  

A0A3Q2LHE3_BIK-02      --LTRRDR----------VSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAG
F7FUT7_BIK-02          --LSSGSW----------VSRK----------------------------
F7FUT7_BIK-01          --LSSGSW----------VSRK----------------------------
I3LVX0_BIK-01          --AAPSTR----------VPPA----------------------------
G1TZR9_BIK-01          --PWSRFC----------LSGL----------------------------
A0A2K5QXZ1_BIK-01      --LSSGSW----------VSRK----------------------------
O70337_BIK-04          --LTPGAW----------VSPD----------------------------
O70337_BIK-02          --LTPGAW----------VSPD----------------------------
O70337_BIK-01          --LTPGAW----------VSPD----------------------------
Q925D2_BIK-01          --FTPGAW----------VSPD----------------------------
A0A1S3FUQ7_BIK-01      --PIPRLQ----------VSPG----------------------------
H0XAE7_BIK-01          --LSRGPW----------VCPA----------------------------
A0A2K6FM79_BIK-01      --LSPRPW----------VCPA----------------------------
H0W025_BIK-01          GRPASRAW----------VSPR----------------------------
A0A2K5CLG5_BIK-01      --LSSGSW----------VSRK----------------------------
A0A2K6TBD7_BIK-01      --LSSGSW----------VSGK----------------------------
H2P4N6_BIK-01          --L-----------------------------------------------
G1S1X2_BIK-01          --PNPGSR----------VSRE----------------------------
G3QCT2_BIK-01          --PNPGSW----------VSRE----------------------------
A0A2R8ZXD2_BIK-01      --PNPRSW----------VSRE----------------------------
H2QLU7_BIK-01          --PNPGSW----------VSRE----------------------------
A0A2K6MCW0_BIK-01      --LNPGSQ----------VSRE----------------------------
A0A2K6QK74_BIK-01      --LNPGSQ----------VSRE----------------------------
A0A0D9QZY8_BIK-01      --LNPGSW----------VSRE----------------------------
A0A2K5VW94_BIK-01      --PNPRSW----------VSRE----------------------------
A0A2K6DBJ4_BIK-01      --PNPRSW----------VSRE----------------------------
A0A2K5J4Q7_BIK-01      --PNPGSR----------VSRE----------------------------
A0A096NKG5_BIK-01      --PNPRSW----------VSRE----------------------------
A0A2K5LDM6_BIK-01      --PNPRSW----------VSHE----------------------------
A0A2K5XSA1_BIK-01      --PNPRSW----------VSRE----------------------------
W5QCU2_BIK-01          --LTLRDR----------VSPS----------------------------
A0A3Q2LHE3_BIK-01      --LTRRDR-----VSLRFHDLD----------------------------
A0A452QUG1_BIK-01      --LTFRNR----------VSPH----------------------------
A0A452V3L2_BIK-01      --LTFRNRGLDLEPSLPATQPQ----------------------------
                                                                         

A0A3Q2LHE3_BIK-02      CHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY----------------
F7FUT7_BIK-02          ----QAVLLALLALLL----AMFSG--GLHLLLK----------------
F7FUT7_BIK-01          ----QAVLLALLALLL----AMFSG--GLHLLLK----------------
I3LVX0_BIK-01          --RACRELLPVLLLLG----LLLSR--ALYLRLQ----------------
G1TZR9_BIK-01          --PLSPPQPDPAGLWV----GAQAS--WVDISLRPVGCHPEQHC------
A0A2K5QXZ1_BIK-01      --QAVL--LAFLALLL----ATFSG--GLHLLLK----------------
O70337_BIK-04          --QDPGQLFPMVLLVF----LLLGG--AWYLQLQ----------------
O70337_BIK-02          --QDPGQLFPMVLLVF----LLLGG--AWYLQLQ----------------
O70337_BIK-01          --QDPGQLFPMVLLVF----LLLGG--AWYLQLQ----------------
Q925D2_BIK-01          --QDPGQLFPMVLLVF----LLLGG--AWHLQLQ----------------
A0A1S3FUQ7_BIK-01      --QVRRQMLPAVL--------LLCG--ALQLLLQ----------------
H0XAE7_BIK-01          --PAWEQVLLLLLLLV----LLLAG--GLHLLLK----------------
A0A2K6FM79_BIK-01      --PAWEQVLLLLLVL-----LLLGG--GLHLLLK----------------
H0W025_BIK-01          --WTCRWLLPVLLLLL----LLL-G--TLRLLLQ----------------
A0A2K5CLG5_BIK-01      --QAVL--LALLALLL----AMFSG--GLHLLLK----------------
A0A2K6TBD7_BIK-01      --QAVL--LALLALLL----AMFSG--GLRLLLK----------------
H2P4N6_BIK-01          --------------------------------------------------
G1S1X2_BIK-01          --QMLLVLLVLLLLLL----PLLSG--GLYLLN-----------------
G3QCT2_BIK-01          --QVLLALLLLLALLL----PLLSG--GLHLLLK----------------
A0A2R8ZXD2_BIK-01      --QVLLALLLLLALLL----PLLSG--GLHLLLK----------------
H2QLU7_BIK-01          --QVLLALLLLLALLL----PLLSG--GLHLLLK----------------
A0A2K6MCW0_BIK-01      --QVLLALLLLLA-------ALLSG--GLHLLLK----------------
A0A2K6QK74_BIK-01      --QVLLALLLLLA-------ALLSG--GLHLLLK----------------
A0A0D9QZY8_BIK-01      --QVLLALL-LLALLL----ALLSG--GLHLLLK----------------
A0A2K5VW94_BIK-01      --QVLLVLLLLLALLL----ALLSG--GLHLLLK----------------
A0A2K6DBJ4_BIK-01      --QVLLVLLLLLALLL----ALLSG--GLHLLLK----------------
A0A2K5J4Q7_BIK-01      --QVLLALLLLLALLL----ALLSG--GLHLLLK----------------
A0A096NKG5_BIK-01      --QVLLALLLLLALLL----ALLSG--GLHLLLK----------------
A0A2K5LDM6_BIK-01      --QVLL----LLALLL----ALLSG--GLHLLLK----------------
A0A2K5XSA1_BIK-01      --QVLL----LLALLL----ALLSG--GLHLLLK----------------
W5QCU2_BIK-01          --LWPELALSLLVVAM----LSWGC--RF---------------------
A0A3Q2LHE3_BIK-01      --SPSCMCSPLEPWSS----CPVGH--SLAGCHSPHQSLLSSFACFTHSS
A0A452QUG1_BIK-01      --PGRRLVLSLLLLLG----LLLGW--GFRLLQ-----------------
A0A452V3L2_BIK-01      --SRSSRCSDSPPPAG----LVRSC--PLPAAPSGPHD------------
                                                                         

A0A3Q2LHE3_BIK-02      ---------------
F7FUT7_BIK-02          ---------------
F7FUT7_BIK-01          ---------------
I3LVX0_BIK-01          ---------------
G1TZR9_BIK-01          ---------------
A0A2K5QXZ1_BIK-01      ---------------
O70337_BIK-04          ---------------
O70337_BIK-02          ---------------
O70337_BIK-01          ---------------
Q925D2_BIK-01          ---------------
A0A1S3FUQ7_BIK-01      ---------------
H0XAE7_BIK-01          ---------------
A0A2K6FM79_BIK-01      ---------------
H0W025_BIK-01          ---------------
A0A2K5CLG5_BIK-01      ---------------
A0A2K6TBD7_BIK-01      ---------------
H2P4N6_BIK-01          ---------------
G1S1X2_BIK-01          ---------------
G3QCT2_BIK-01          ---------------
A0A2R8ZXD2_BIK-01      ---------------
H2QLU7_BIK-01          ---------------
A0A2K6MCW0_BIK-01      ---------------
A0A2K6QK74_BIK-01      ---------------
A0A0D9QZY8_BIK-01      ---------------
A0A2K5VW94_BIK-01      ---------------
A0A2K6DBJ4_BIK-01      ---------------
A0A2K5J4Q7_BIK-01      ---------------
A0A096NKG5_BIK-01      ---------------
A0A2K5LDM6_BIK-01      ---------------
A0A2K5XSA1_BIK-01      ---------------
W5QCU2_BIK-01          ---------------
A0A3Q2LHE3_BIK-01      SCLFPGPLGLRWLAY
A0A452QUG1_BIK-01      ---------------
A0A452V3L2_BIK-01      ---------------
                                      

© 1998-2020Legal notice