Dataset for protein Bik of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

42 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3LVX0_BIK-01          --------------------------------------------------
Q925D2_BIK-02          --------------------------------------------------
A0A2K5QXZ1_BIK-01      --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
Q925D2_BIK-01          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
G1TZR9_BIK-01          --------------------------------------------------
H0XAE7_BIK-01          --------------------------------------------------
A0A2K6FM79_BIK-01      --------------------------------------------------
A0A2K5CLG5_BIK-01      --------------------------------------------------
A0A2K6TBD7_BIK-01      --------------------------------------------------
G1S1X2_BIK-01          --------------------------------------------------
H2P4N6_BIK-01          --------------------------------------------------
G3QCT2_BIK-01          --------------------------------------------------
A0A2R8ZXD2_BIK-01      --------------------------------------------------
H2QLU7_BIK-01          --------------------------------------------------
Q13323_BIK-01          --------------------------------------------------
A0A2K6MCW0_BIK-01      --------------------------------------------------
A0A2K6QK74_BIK-01      --------------------------------------------------
A0A0D9QZY8_BIK-01      --------------------------------------------------
F6SUD3_BIK-01          --------------------------------------------------
A0A2K6DBJ4_BIK-01      --------------------------------------------------
A0A2K5J4Q7_BIK-01      --------------------------------------------------
A0A096NKG5_BIK-01      --------------------------------------------------
A0A2K5LDM6_BIK-01      --------------------------------------------------
A0A2K5XSA1_BIK-01      --------------------------------------------------
H0W025_BIK-01          --------------------------------------------------
A0A2K5VW94_BIK-01      --------------------------------------------------
W5QCU2_BIK-01          --------------------------------------------------
A0A3Q2LHE3_BIK-01      --------------------------------------------------
A0A452QUG1_BIK-01      --------------------------------------------------
A0A452V3L2_BIK-01      --------------------------------------------------
A0A5F5XUY6_BIK-01      -----------------------------------MNLGVDTNTQSTANW
A0A3Q2LHE3_BIK-02      --------------------------------------------------
A0A7N5KDU2_BIK-01      MGMEKSTVASGLLGGRMGQSCQDPGSYTQIQPLDSSTSTPWRLLNAPPCW
A0A3Q7V097_BIK-03      ------------------------------MTLACSSMRTIGPNVTLSGV
A0A3Q7V097_BIK-01      --------------------------------------------------
A0A3Q7V097_BIK-02      --------------------------------------------------
A0A667G4D3_BIK-01      --------------------------------------------------
A0A673V4V4_BIK-01      --------------------------------------------------
                                                                         

I3LVX0_BIK-01          --------------------------------------------------
Q925D2_BIK-02          -------------------------------------------------M
A0A2K5QXZ1_BIK-01      --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
Q925D2_BIK-01          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
G1TZR9_BIK-01          --------------------------------------------------
H0XAE7_BIK-01          --------------------------------------------------
A0A2K6FM79_BIK-01      --------------------------------------------------
A0A2K5CLG5_BIK-01      --------------------------------------------------
A0A2K6TBD7_BIK-01      --------------------------------------------------
G1S1X2_BIK-01          --------------------------------------------------
H2P4N6_BIK-01          --------------------------------------------------
G3QCT2_BIK-01          --------------------------------------------------
A0A2R8ZXD2_BIK-01      --------------------------------------------------
H2QLU7_BIK-01          --------------------------------------------------
Q13323_BIK-01          --------------------------------------------------
A0A2K6MCW0_BIK-01      --------------------------------------------------
A0A2K6QK74_BIK-01      --------------------------------------------------
A0A0D9QZY8_BIK-01      --------------------------------------------------
F6SUD3_BIK-01          --------------------------------------------------
A0A2K6DBJ4_BIK-01      --------------------------------------------------
A0A2K5J4Q7_BIK-01      --------------------------------------------------
A0A096NKG5_BIK-01      --------------------------------------------------
A0A2K5LDM6_BIK-01      --------------------------------------------------
A0A2K5XSA1_BIK-01      --------------------------------------------------
H0W025_BIK-01          --------------------------------------------------
A0A2K5VW94_BIK-01      --------------------------------------------------
W5QCU2_BIK-01          --------------------------------------------------
A0A3Q2LHE3_BIK-01      --------------------------------------------------
A0A452QUG1_BIK-01      --------------------------------------------------
A0A452V3L2_BIK-01      --------------------------------------------------
A0A5F5XUY6_BIK-01      GKANCKISRQENSCVVLPLGWSVLSRKGHKRKSPHGLFSKRGIRGPEGLR
A0A3Q2LHE3_BIK-02      -------------------------------------MRKRRRHAAAKRQ
A0A7N5KDU2_BIK-01      ETALADGGAQTAHTFTQPPRTRGRGSGAAGRERRPRGRAGAGPAVYKLAR
A0A3Q7V097_BIK-03      SPAGGTAWAHWEEAGRRVACLLRTPSFTRQLAGIKAGFAELQRNQESSIS
A0A3Q7V097_BIK-01      ----------------------------------------------MGRW
A0A3Q7V097_BIK-02      --------------------------------------------------
A0A667G4D3_BIK-01      --------------------------------------------------
A0A673V4V4_BIK-01      --------------------------------------------------
                                                                         

I3LVX0_BIK-01          --------------------------------------------------
Q925D2_BIK-02          ASAPVSARTWEFASVPPLGILGSVPFLPRSEDMSEARLMARDII-KTLLH
A0A2K5QXZ1_BIK-01      --------------------------------MSEERPLSIDILMETLLC
O70337_BIK-04          --------------------------------------------------
Q925D2_BIK-01          --------------------------------MSEARLMARDII-KTLLH
O70337_BIK-03          --------------------------------MSEARLMARDVI-KTVPH
O70337_BIK-01          --------------------------------MSEARLMARDVI-KTVPH
O70337_BIK-02          --------------------------------MSEARLMARDVI-KTVPH
G1TZR9_BIK-01          --------------------------------MSEVRPGSRDLFQEALLD
H0XAE7_BIK-01          --------------------------------MSAGRPVSMDHFMETFPF
A0A2K6FM79_BIK-01      --------------------------------MSEVRPVSTDLLMETFPF
A0A2K5CLG5_BIK-01      --------------------------------MSEVRPLSSDILMETLLC
A0A2K6TBD7_BIK-01      --------------------------------MSEDRPLSSDILMETLLC
G1S1X2_BIK-01          --------------------------------MSEVRPISRDILMESLLY
H2P4N6_BIK-01          --------------------------------MSEVRPISRDILMETLLY
G3QCT2_BIK-01          --------------------------------MSEVRPLSRDILMETLLY
A0A2R8ZXD2_BIK-01      --------------------------------MSEVRPLSRDILMETLLY
H2QLU7_BIK-01          --------------------------------MSEVRPLSRDILMETLLY
Q13323_BIK-01          --------------------------------MSEVRPLSRDILMETLLY
A0A2K6MCW0_BIK-01      --------------------------------MSGVRPVSRDILMETLLY
A0A2K6QK74_BIK-01      --------------------------------MSGVRPVSRDILMETLLY
A0A0D9QZY8_BIK-01      --------------------------------MSGVRPISRHILMESLLY
F6SUD3_BIK-01          --------------------------------MSGVRPISRDTLMETLLY
A0A2K6DBJ4_BIK-01      --------------------------------MSGVRPISRDTLMETLLY
A0A2K5J4Q7_BIK-01      --------------------------------MSGVRPISRDILMETLLY
A0A096NKG5_BIK-01      --------------------------------MSGVRPISRDILMETLLY
A0A2K5LDM6_BIK-01      --------------------------------MSGVRPISRDTWMETLLY
A0A2K5XSA1_BIK-01      --------------------------------MSGVRPISRDTLMETLLY
H0W025_BIK-01          --------------------------------MSEAKPVARDPLMETPLF
A0A2K5VW94_BIK-01      -----------------------MLSFCPKGEMSGVRPISRDTLMETLLY
W5QCU2_BIK-01          --------------------------------MYQARPLSRNLFLYTFLQ
A0A3Q2LHE3_BIK-01      --------------------------------MSQVGPVSRDLFLDAFLH
A0A452QUG1_BIK-01      --------------------------------FHTTRRCAQRVVAPSLHH
A0A452V3L2_BIK-01      -------------------MAWSSEEARSREEMSHTGPLSRNLFLSTFLQ
A0A5F5XUY6_BIK-01      NLSGAKRPSWTRTQVAQQPSAPWHSVPVHREEMSHAGPLSRNVFLSTFLQ
A0A3Q2LHE3_BIK-02      TWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLH
A0A7N5KDU2_BIK-01      RPEAADNTAPGSSAPAATIAATAAATSDAREEMSHTGPLSRNLFLSTFLQ
A0A3Q7V097_BIK-03      PFFSSPDGLGCGRGCSEDGSIRWLGLHADLGEMSHSGPLSRNLFLSTFLQ
A0A3Q7V097_BIK-01      RRGMLLTMFLPKHHSWFSDCEIGRNIPNSREEMSHSGPLSRNLFLSTFLQ
A0A3Q7V097_BIK-02      --------------------------------MSHSGPLSRNLFLSTFLQ
A0A667G4D3_BIK-01      --------------------------------MSHAGPLSRNVFLSTFLQ
A0A673V4V4_BIK-01      ------------------------MTEPNREEMSHAGPLSRDVFLSTFLQ
                                                                         

I3LVX0_BIK-01          ------------------------------------MVQGSHQVALRLAC
Q925D2_BIK-02          DQVP--QPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLAC
A0A2K5QXZ1_BIK-01      EQFM--DPLTMEVVGGGSDP--EEDLDPVED--PLECMENSDALALQLAC
O70337_BIK-04          -------------------------------------MFTRNQVALRLAC
Q925D2_BIK-01          DQVP--QPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLAC
O70337_BIK-03          DQVP--QPPVASETPSMKE--------PVRDVDLMECVEGRNQVALRLAC
O70337_BIK-01          DQVP--QPPVASETPSMKE--------PVRDVDLMECVEGRNQVALRLAC
O70337_BIK-02          DQVP--QPPVASETPSMKE--------PVRDVDLMECVEGRNQVALRLAC
G1TZR9_BIK-01          EQVP--EPLLTAEVPGLTRPVEEGDLD------LMECLEGSNQVALRLAY
H0XAE7_BIK-01          EQLL--EPLTME-VLGMTE------------PNPMECLEDSDQVALRLAC
A0A2K6FM79_BIK-01      EHLL--DPLILE-VLSIMDN--------EENPDPSGCLEDSDEVALRLAC
A0A2K5CLG5_BIK-01      EQFV--HPLTME-VVGGSDP--EEDLDPVED--PLECMENSDALVLQLAC
A0A2K6TBD7_BIK-01      EQFV--DPLTME-VVGGSDP--EEDPDSVED--PLECMENSDALALQLAC
G1S1X2_BIK-01          EQLL--EPPTME-VLGVTDP--EEDLDPMEDFDPLQCMEGSDALAPRLAC
H2P4N6_BIK-01          EQLL--EPPTME-VLGVTDS--EEDLDPMEDFSPLECMEGSDALALRLAC
G3QCT2_BIK-01          EQLL--EPPTME-VLGVTDS--EEDLDPMEDFDSLECMEGSDALALRLAC
A0A2R8ZXD2_BIK-01      EQLL--EPPTME-VLGVTES--EEDLDPMEDFDSLECMEGSDALALRLAC
H2QLU7_BIK-01          EQLL--EPPTME-VLGVTDS--EEDLDPMEDFDSLECMEGSDALALRLAC
Q13323_BIK-01          EQLL--EPPTME-VLGMTDS--EEDLDPMEDFDSLECMEGSDALALRLAC
A0A2K6MCW0_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
A0A2K6QK74_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
A0A0D9QZY8_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
F6SUD3_BIK-01          EQLL--EPLTME-VLGVTDP--EEDLDPMEDFNPLECMEDSDMLALRLAC
A0A2K6DBJ4_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECIEDSDMLALRLAC
A0A2K5J4Q7_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
A0A096NKG5_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
A0A2K5LDM6_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
A0A2K5XSA1_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
H0W025_BIK-01          EPPP--GPLLAEGALGVTQPLWAEDLSPPGDTNLMECVEGSSLVALRLAC
A0A2K5VW94_BIK-01      EQLL--EPLTME-VLGVTDP--EEDLDPMEDFDPLECMEDSDMLALRLAC
W5QCU2_BIK-01          NH----GPGFLDDQGSGLPG--VTSILEFH--PISPYSDSPHYLAMQLAS
A0A3Q2LHE3_BIK-01      ER----SPEALE-----VPG--MTELT-----ESSPDSDNRDSVAMRLAF
A0A452QUG1_BIK-01      QHPAGEGAVLTG-----AGG--ICQ-------ATGPLCNNPDDVAMRLAF
A0A452V3L2_BIK-01      EH----GPEVLE-----VPG--MTDLVEYYDPGPSPNSNNPDDVAMRLAF
A0A5F5XUY6_BIK-01      EH----GPEVLD-VPG------MTDLVEYYDPGPSPNSNSPDDVAMRLAF
A0A3Q2LHE3_BIK-02      ER----SPEALE-VPG------MTELTE-----SSPDSDNRDSVAMRLAF
A0A7N5KDU2_BIK-01      EH----GPEVLE-VPG------MTDLVEYYDPGPSPNSNNPDDVAMRLAF
A0A3Q7V097_BIK-03      EH----GPEVLE-VPG------MTDLMEYYDPGPSPNSNNPDDVAMRLAF
A0A3Q7V097_BIK-01      EH----GPEVLE-VPG------MTDLMEYYDPGPSPNSNNPDDVAMRLAF
A0A3Q7V097_BIK-02      EH----GPEVLE-VPG------MTDLMEYYDPGPSPNSNNPDDVAMRLAF
A0A667G4D3_BIK-01      EH----GPEVLD-VPG------MTDLVEYYDPGPSPNSNSPDDVAMRLAF
A0A673V4V4_BIK-01      EH----GPEVLD-VPG------VTDLVEYYDPGPSPNSNSPDDVAMRLAF
                                                                  :. .** 

I3LVX0_BIK-01          IGDEMDLCFQDLQLAQLPGMAMHSLALSYSQA---RVTGVLRSL---AQG
Q925D2_BIK-02          IGDEMDRCLRSPRLVQLPGIAMHRLAATYSQT---GVRGIFRSL---IGS
A0A2K5QXZ1_BIK-01      IADQMDVSLRARKLAQLYEVAMYSPGLAVTLDQT-DIRDVLGGI---VDI
O70337_BIK-04          IGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRT---GVRGIFRSL---IRS
Q925D2_BIK-01          IGDEMDRCLRSPRLVQLPGIAMHRLAATYSQT---GVRGIFRSL---IGS
O70337_BIK-03          IGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRT---GVRGIFRSL---IRS
O70337_BIK-01          IGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRT---GVRGIFRSL---IRS
O70337_BIK-02          IGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRT---GVRGIFRSL---IRS
G1TZR9_BIK-01          IGDEMDLH---PRRYTSARLLVPSYSLAFTYSQT-GFTGVLGSVGLHLAS
H0XAE7_BIK-01          IGDEMDLHLRSPRLAQLSRMTMHSLG--LSYNQT-DGQGVLRSV---ISG
A0A2K6FM79_BIK-01      IGDEMDLCLRSPRLAWLPGMTMHSLGLALSCDQP-VRWGVLGSL---SDG
A0A2K5CLG5_BIK-01      IADQMDVSLRARRLAQLYEVAMYSPGLAFILDRT-DIGDVLSGI---VEV
A0A2K6TBD7_BIK-01      IADQMDVSLRARRLAQLYEVATYSPGLAFILDRT-DIRDVLSGV---VDV
G1S1X2_BIK-01          IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSF---MDG
H2P4N6_BIK-01          IGDEMDVSLRAPRRAQLPEVAMHSLGLAFIYDQTEDIRDVLRSF---TDG
G3QCT2_BIK-01          IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSF---MDG
A0A2R8ZXD2_BIK-01      IGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSF---MDG
H2QLU7_BIK-01          IGDEMDVSLRAPRLAQLSDVAMHSLGLAFIYDQTEDIRDVLRSF---MDG
Q13323_BIK-01          IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSF---MDG
A0A2K6MCW0_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLTSF---MDG
A0A2K6QK74_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLTSF---MDG
A0A0D9QZY8_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSF---IDG
F6SUD3_BIK-01          IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSF---MDG
A0A2K6DBJ4_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSF---MDG
A0A2K5J4Q7_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSF---MDG
A0A096NKG5_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSF---MDG
A0A2K5LDM6_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFICDQTDDIRDVLRSF---MDG
A0A2K5XSA1_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSF---LDG
H0W025_BIK-01          IGDEMDLRLRSPRLAQLPGRAVHSLAIT--YSQM-GLWGVLGRL---TLS
A0A2K5VW94_BIK-01      IGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSF---MDG
W5QCU2_BIK-01          IADEMELRLLLPQFVEPFWMPMYSLCFPYSHV---GLRDVLRSF---MVA
A0A3Q2LHE3_BIK-01      IGDEMEVRWMLPHIAELPGVAVYSLAFTYNQT---GLRGVFRSF---MDG
A0A452QUG1_BIK-01      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSL---MDG
A0A452V3L2_BIK-01      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSL---MDG
A0A5F5XUY6_BIK-01      IGDEMEVRWMMPRVGELPGMAVYSLAFTYNQT---GLRGVLRSL---MDG
A0A3Q2LHE3_BIK-02      IGDEMEVRWMLPHIAELPGVAVYSLAFTYNQT---GLRGVFRSF---MDG
A0A7N5KDU2_BIK-01      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSL---VDG
A0A3Q7V097_BIK-03      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSF---LDG
A0A3Q7V097_BIK-01      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSF---LDG
A0A3Q7V097_BIK-02      IGDEMEVRWMLPRVGELPGMAMYSLAFTYNQT---GLRGVLRSF---LDG
A0A667G4D3_BIK-01      IGDEMEGRWMMPRVGELPGMAVYSLAFTYNQT---GLRGVLRSL---MDG
A0A673V4V4_BIK-01      IGDEMEVRWMVPRVGELPGMALYSLAFTYNQT---GLRGVLRSL---MDG
                       *.*:*:      .                         .::  .      

I3LVX0_BIK-01          LASLRENM-WFWRP--AAPSTR----------VPPA--------------
Q925D2_BIK-02          LTNLRENIWS-WRV--FTPGAW----------VSPD--------------
A0A2K5QXZ1_BIK-01      FANFQEDVVRLWRS--LSSGSW----------VSRK--------------
O70337_BIK-04          LTNLRENIWS-WRV--LTPGAW----------VSPD--------------
Q925D2_BIK-01          LTNLRENIWS-WRV--FTPGAW----------VSPD--------------
O70337_BIK-03          LTNLRENIWS-WRV--LTPGAW----------VSPD--------------
O70337_BIK-01          LTNLRENIWS-WRV--LTPGAW----------VSPD--------------
O70337_BIK-02          LTNLRENIWS-WRV--LTPGAW----------VSPD--------------
G1TZR9_BIK-01          LVELWSPWVRAWGA--PWSRFC----------LSGL--------------
H0XAE7_BIK-01          FTNLRENIAGFWRS--LSRGPW----------VCPA--------------
A0A2K6FM79_BIK-01      FANLREYVARLWRS--LSPRPW----------VCPA--------------
A0A2K5CLG5_BIK-01      FANFQEDIVRLWRS--LSSGSW----------VSRK--------------
A0A2K6TBD7_BIK-01      FADFQEDIVRLWRS--LSSGSW----------VSGK--------------
G1S1X2_BIK-01          FTTFKENIIRLWRS--PNPGSR----------VSRE--------------
H2P4N6_BIK-01          FTTLKENIMRFWSS--LNPGSW----------VSRE--------------
G3QCT2_BIK-01          FTTLKENIMRFWRS--PNPGSW----------VSRE--------------
A0A2R8ZXD2_BIK-01      FTTLKENIMRFWRS--PNPRSW----------VSRE--------------
H2QLU7_BIK-01          FTTLKENIMRFWRS--PNPGSW----------VSRE--------------
Q13323_BIK-01          FTTLKENIMRFWRS--PNPGSW----------VSCE--------------
A0A2K6MCW0_BIK-01      FTTLKENIMRFWRS--LNPGSQ----------VSRE--------------
A0A2K6QK74_BIK-01      FTTLKENIMRFWRS--LNPGSQ----------VSRE--------------
A0A0D9QZY8_BIK-01      FTTLRENIMRFWRS--LNPGSW----------VSRE--------------
F6SUD3_BIK-01          FTTLRENIMRFWRS--PNPRSW----------VSRE--------------
A0A2K6DBJ4_BIK-01      FTTLRENIMRFWRS--PNPRSW----------VSRE--------------
A0A2K5J4Q7_BIK-01      FTTLKENIMRFWRS--PNPGSR----------VSRE--------------
A0A096NKG5_BIK-01      FTTLRENIMRFWRS--PNPRSW----------VSRE--------------
A0A2K5LDM6_BIK-01      FTTLRENIMRFWRS--PNPRSW----------VSHE--------------
A0A2K5XSA1_BIK-01      FTTLRENIMRFWRS--PNPRSW----------VSRE--------------
H0W025_BIK-01          LASLRDNV---WACGRPASRAW----------VSPR--------------
A0A2K5VW94_BIK-01      FTTLRENIMRFWRS--PNPRSW----------VSRE--------------
W5QCU2_BIK-01          FTNLRENR-RLWSF--LTLRDR----------VSPS--------------
A0A3Q2LHE3_BIK-01      LTNLRENI-RFWSF--LTRRDR-----VSLRFHDLD--------------
A0A452QUG1_BIK-01      LTNLRENI-RIWSF--LTFRNR----------VSPH--------------
A0A452V3L2_BIK-01      LTNLRENI-RIWSF--LTFRNRGLDLEPSLPATQPQ--------------
A0A5F5XUY6_BIK-01      LANLRENI-WIWGF--LTLRNR----------VSPN--------------
A0A3Q2LHE3_BIK-02      LTNLRENI-RFWSF--LTRRDR----------VSLRFHDLDSPSCMCSPL
A0A7N5KDU2_BIK-01      LTNLRENV-RIWSF--LTFRNR----------VSPH--------------
A0A3Q7V097_BIK-03      LANLRENI-RIWSF--LTFRNR----------VSPN--------------
A0A3Q7V097_BIK-01      LANLRENI-RIWSF--LTFRNR----------VSPN--------------
A0A3Q7V097_BIK-02      LANLRENI-RIWSF--LTFRNR----------VSPN--------------
A0A667G4D3_BIK-01      LANLRENI-RIWGF--LTLRNR----------VSPN--------------
A0A673V4V4_BIK-01      LASLRENI-RVWSF--LTLRNR----------VSPN--------------
                       :. :..     *                                      

I3LVX0_BIK-01          -------RACRELLPVLLLLGLLLSR---------------ALYLRLQ--
Q925D2_BIK-02          -------QDPGQLFPMVLLVFLLLGG---------------AWHLQLQ--
A0A2K5QXZ1_BIK-01      -------QAVL--LAFLALLLATFSG---------------GLHLLLK--
O70337_BIK-04          -------QDPGQLFPMVLLVFLLLGG---------------AWYLQLQ--
Q925D2_BIK-01          -------QDPGQLFPMVLLVFLLLGG---------------AWHLQLQ--
O70337_BIK-03          -------QDPGQLFPMVLLVFLLLGG------------------------
O70337_BIK-01          -------QDPGQLFPMVLLVFLLLGG---------------AWYLQLQ--
O70337_BIK-02          -------QDPGQLFPMVLLVFLLLGG---------------AWYLQLQ--
G1TZR9_BIK-01          -------PLSPPQPDPAGLWVGAQAS---------------WVDISLRPV
H0XAE7_BIK-01          -------PAWEQVLLLLLLLVLLLAG---------------GLHLLLK--
A0A2K6FM79_BIK-01      -------PAWEQVLLLLLVL-LLLGG---------------GLHLLLK--
A0A2K5CLG5_BIK-01      -------QAVL--LALLALLLAMFSG---------------GLHLLLK--
A0A2K6TBD7_BIK-01      -------QAVL--LALLALLLAMFSG---------------GLRLLLK--
G1S1X2_BIK-01          -------QMLLVLLVLLLLLLPLLSG---------------GLYLLN---
H2P4N6_BIK-01          -------QVLLALLLL------LLSG---------------GLHLLLK--
G3QCT2_BIK-01          -------QVLLALLLLLALLLPLLSG---------------GLHLLLK--
A0A2R8ZXD2_BIK-01      -------QVLLALLLLLALLLPLLSG---------------GLHLLLK--
H2QLU7_BIK-01          -------QVLLALLLLLALLLPLLSG---------------GLHLLLK--
Q13323_BIK-01          -------QVLLALLLLLALLLPLLSG---------------GLHLLLK--
A0A2K6MCW0_BIK-01      -------QVLLALLLLLA---ALLSG---------------GLHLLLK--
A0A2K6QK74_BIK-01      -------QVLLALLLLLA---ALLSG---------------GLHLLLK--
A0A0D9QZY8_BIK-01      -------QVLLA-LLLLALLLALLSG---------------GLHLLLK--
F6SUD3_BIK-01          -------QVLLVLLLLLALLLALLSG---------------GLHLLLK--
A0A2K6DBJ4_BIK-01      -------QVLLVLLLLLALLLALLSG---------------GLHLLLK--
A0A2K5J4Q7_BIK-01      -------QVLLALLLLLALLLALLSG---------------GLHLLLK--
A0A096NKG5_BIK-01      -------QVLLALLLLLALLLALLSG---------------GLHLLLK--
A0A2K5LDM6_BIK-01      -------QV----LLLLALLLALLSG---------------GLHLLLK--
A0A2K5XSA1_BIK-01      -------QV----LLLLALLLALLSG---------------GLHLLLK--
H0W025_BIK-01          -------WTCRWLLPVLLLLLLLL-G---------------TLRLLLQ--
A0A2K5VW94_BIK-01      -------QVLLVLLLLLALLLALLSG---------------GLHLLLK--
W5QCU2_BIK-01          -------LWPELALSLLVVAMLSWGC---------------RF-------
A0A3Q2LHE3_BIK-01      -------SPSCMCSPLEPWSSCPVGH---------------SLAGCHSPH
A0A452QUG1_BIK-01      -------PGRRLVLSLLLLLGLLLGW---------------GFRLLQ---
A0A452V3L2_BIK-01      -------SRSSRCSDSPPPAGLVRSC---------------PLPAAPSGP
A0A5F5XUY6_BIK-01      -------SGRGLALS-LLLLVLLLGW---------------GLHLLQ---
A0A3Q2LHE3_BIK-02      EPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY--
A0A7N5KDU2_BIK-01      -------PGRGLVLSLLLLLGLLLGW---------------GFRLLQ---
A0A3Q7V097_BIK-03      -------PGRGLVLSLLLLLVLLLGW---------------GLRLLQ---
A0A3Q7V097_BIK-01      -------PGRGLVLSLLLLLVLLLGW---------------GLRLLQ---
A0A3Q7V097_BIK-02      -------PGRGLVLSLLLLLVLLLGW---------------GLRLLQ---
A0A667G4D3_BIK-01      -------SGRGLALS-LLLLVLLLGW---------------GLHLLQ---
A0A673V4V4_BIK-01      -------AGRGLALS-LLLLVLLLSW---------------GLHHLQ---
                                                                         

I3LVX0_BIK-01          -----------------------------
Q925D2_BIK-02          -----------------------------
A0A2K5QXZ1_BIK-01      -----------------------------
O70337_BIK-04          -----------------------------
Q925D2_BIK-01          -----------------------------
O70337_BIK-03          -----------------------------
O70337_BIK-01          -----------------------------
O70337_BIK-02          -----------------------------
G1TZR9_BIK-01          GCHPEQHC---------------------
H0XAE7_BIK-01          -----------------------------
A0A2K6FM79_BIK-01      -----------------------------
A0A2K5CLG5_BIK-01      -----------------------------
A0A2K6TBD7_BIK-01      -----------------------------
G1S1X2_BIK-01          -----------------------------
H2P4N6_BIK-01          -----------------------------
G3QCT2_BIK-01          -----------------------------
A0A2R8ZXD2_BIK-01      -----------------------------
H2QLU7_BIK-01          -----------------------------
Q13323_BIK-01          -----------------------------
A0A2K6MCW0_BIK-01      -----------------------------
A0A2K6QK74_BIK-01      -----------------------------
A0A0D9QZY8_BIK-01      -----------------------------
F6SUD3_BIK-01          -----------------------------
A0A2K6DBJ4_BIK-01      -----------------------------
A0A2K5J4Q7_BIK-01      -----------------------------
A0A096NKG5_BIK-01      -----------------------------
A0A2K5LDM6_BIK-01      -----------------------------
A0A2K5XSA1_BIK-01      -----------------------------
H0W025_BIK-01          -----------------------------
A0A2K5VW94_BIK-01      -----------------------------
W5QCU2_BIK-01          -----------------------------
A0A3Q2LHE3_BIK-01      QSLLSSFACFTHSSSCLFPGPLGLRWLAY
A0A452QUG1_BIK-01      -----------------------------
A0A452V3L2_BIK-01      HD---------------------------
A0A5F5XUY6_BIK-01      -----------------------------
A0A3Q2LHE3_BIK-02      -----------------------------
A0A7N5KDU2_BIK-01      -----------------------------
A0A3Q7V097_BIK-03      -----------------------------
A0A3Q7V097_BIK-01      -----------------------------
A0A3Q7V097_BIK-02      -----------------------------
A0A667G4D3_BIK-01      -----------------------------
A0A673V4V4_BIK-01      -----------------------------
                                                    

© 1998-2022Legal notice