Dataset for protein Bik of organism all

[Download (right click)] [Alignment] [Repertoires]

42 sequence(s)

>gnl|bcl2dbpro|A0A7N5KDU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BIK (length=281 residues).
MGMEKSTVASGLLGGRMGQSCQDPGSYTQIQPLDSSTSTPWRLLNAPPCWETALADGGAQTAHTFTQPPRTRGRGSGAAG
RERRPRGRAGAGPAVYKLARRPEAADNTAPGSSAPAATIAATAAATSDAREEMSHTGPLSRNLFLSTFLQEHGPEVLEVP
GMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSLVDGLTNLREN
VRIWSFLTFRNRVSPHPGRGLVLSLLLLLGLLLGWGFRLLQ
>gnl|bcl2dbpro|A0A2K5CLG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Aotus nancymaae GN=BIK (length=155 residues).
MSEVRPLSSDILMETLLCEQFVHPLTMEVVGGSDPEEDLDPVEDPLECMENSDALVLQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFILDRTDIGDVLSGIVEVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|H0W025_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cavia porcellus GN=BIK (length=158 residues).
MSEAKPVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDLSPPGDTNLMECVEGSSLVALRLACIGDEMDLRLRSPRL
AQLPGRAVHSLAITYSQMGLWGVLGRLTLSLASLRDNVWACGRPASRAWVSPRWTCRWLLPVLLLLLLLLGTLRLLLQ
>gnl|bcl2dbpro|A0A2K5QXZ1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cebus imitator GN=BIK (length=156 residues).
MSEERPLSIDILMETLLCEQFMDPLTMEVVGGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARKLAQLY
EVAMYSPGLAVTLDQTDIRDVLGGIVDIFANFQEDVVRLWRSLSSGSWVSRKQAVLLAFLALLLATFSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5LDM6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cercocebus atys GN=BIK (length=156 residues).
MSGVRPISRDTWMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFICDQTDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSHEQVLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A0D9QZY8_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BIK (length=159 residues).
MSGVRPISRHILMESLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFIDGFTTLRENIMRFWRSLNPGSWVSREQVLLALLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5J4Q7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Colobus angolensis palliatus GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=226 residues).
MRKRRRHAAAKRQTWDSNSGPLVSEPRSSSSYSVPKAVWSSVGEEMSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTE
SSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFTYNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDR
VSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFACFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A3Q2LHE3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Equus caballus GN=BIK (length=181 residues).
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTESSPDSDNRDSVAMRLAFIGDEMEVRWMLPHIAELPGVAVYSLAFT
YNQTGLRGVFRSFMDGLTNLRENIRFWSFLTRRDRVSLRFHDLDSPSCMCSPLEPWSSCPVGHSLAGCHSPHQSLLSSFA
CFTHSSSCLFPGPLGLRWLAY
>gnl|bcl2dbpro|A0A5F5XUY6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Felis catus GN=BIK (length=245 residues).
MNLGVDTNTQSTANWGKANCKISRQENSCVVLPLGWSVLSRKGHKRKSPHGLFSKRGIRGPEGLRNLSGAKRPSWTRTQV
AQQPSAPWHSVPVHREEMSHAGPLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEME
VRWMMPRVGELPGMAVYSLAFTYNQTGLRGVLRSLMDGLANLRENIWIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWG
LHLLQ
>gnl|bcl2dbpro|G3QCT2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Gorilla gorilla gorilla GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|Q13323_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Homo sapiens GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|I3LVX0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ictidomys tridecemlineatus GN=BIK (length=107 residues).
MVQGSHQVALRLACIGDEMDLCFQDLQLAQLPGMAMHSLALSYSQARVTGVLRSLAQGLASLRENMWFWRPAAPSTRVPP
ARACRELLPVLLLLGLLLSRALYLRLQ
>gnl|bcl2dbpro|A0A667G4D3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Lynx canadensis GN=BIK (length=148 residues).
MSHAGPLSRNVFLSTFLQEHGPEVLDVPGMTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEMEGRWMMPRVGELPGMAVY
SLAFTYNQTGLRGVLRSLMDGLANLRENIRIWGFLTLRNRVSPNSGRGLALSLLLLVLLLGWGLHLLQ
>gnl|bcl2dbpro|A0A2K5VW94_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca fascicularis GN=BIK (length=169 residues).
MLSFCPKGEMSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVS
LRAPRLAQLSEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALL
SGGLHLLLK
>gnl|bcl2dbpro|F6SUD3_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca mulatta GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFNPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6DBJ4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Macaca nemestrina GN=BIK (length=160 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECIEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5XSA1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mandrillus leucophaeus GN=BIK (length=156 residues).
MSGVRPISRDTLMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFLDGFTTLRENIMRFWRSPNPRSWVSREQVLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|O70337_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=143 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGG
>gnl|bcl2dbpro|O70337_BIK-04 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=106 residues).
MFTRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIHRLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPD
QDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|O70337_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Mus musculus GN=BIK (length=150 residues).
MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPRLVQLPGIAIH
RLAVTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ
>gnl|bcl2dbpro|G1S1X2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Nomascus leucogenys GN=BIK (length=159 residues).
MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVSREQMLLVLLVLLLLLLPLLSGGLYLLN
>gnl|bcl2dbpro|G1TZR9_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Oryctolagus cuniculus GN=BIK (length=166 residues).
MSEVRPGSRDLFQEALLDEQVPEPLLTAEVPGLTRPVEEGDLDLMECLEGSNQVALRLAYIGDEMDLHPRRYTSARLLVP
SYSLAFTYSQTGFTGVLGSVGLHLASLVELWSPWVRAWGAPWSRFCLSGLPLSPPQPDPAGLWVGAQASWVDISLRPVGC
HPEQHC
>gnl|bcl2dbpro|H0XAE7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Otolemur garnettii GN=BIK (length=147 residues).
MSAGRPVSMDHFMETFPFEQLLEPLTMEVLGMTEPNPMECLEDSDQVALRLACIGDEMDLHLRSPRLAQLSRMTMHSLGL
SYNQTDGQGVLRSVISGFTNLRENIAGFWRSLSRGPWVCPAPAWEQVLLLLLLLVLLLAGGLHLLLK
>gnl|bcl2dbpro|W5QCU2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ovis aries GN=BIK (length=148 residues).
MYQARPLSRNLFLYTFLQNHGPGFLDDQGSGLPGVTSILEFHPISPYSDSPHYLAMQLASIADEMELRLLLPQFVEPFWM
PMYSLCFPYSHVGLRDVLRSFMVAFTNLRENRRLWSFLTLRDRVSPSLWPELALSLLVVAMLSWGCRF
>gnl|bcl2dbpro|A0A2R8ZXD2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan paniscus GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTESEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPRSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|H2QLU7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pan troglodytes GN=BIK (length=160 residues).
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQL
SDVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSREQVLLALLLLLALLLPLLSGGLHLLLK
>gnl|bcl2dbpro|A0A096NKG5_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Papio anubis GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|H2P4N6_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Pongo abelii GN=BIK (length=154 residues).
MSEVRPISRDILMETLLYEQLLEPPTMEVLGVTDSEEDLDPMEDFSPLECMEGSDALALRLACIGDEMDVSLRAPRRAQL
PEVAMHSLGLAFIYDQTEDIRDVLRSFTDGFTTLKENIMRFWSSLNPGSWVSREQVLLALLLLLLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6FM79_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Propithecus coquereli GN=BIK (length=152 residues).
MSEVRPVSTDLLMETFPFEHLLDPLILEVLSIMDNEENPDPSGCLEDSDEVALRLACIGDEMDLCLRSPRLAWLPGMTMH
SLGLALSCDQPVRWGVLGSLSDGFANLREYVARLWRSLSPRPWVCPAPAWEQVLLLLLVLLLLGGGLHLLLK
>gnl|bcl2dbpro|Q925D2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=158 residues).
MSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDLDFMRCLESRNQVALRLACIGDEMDRCLRSPRLV
QLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
>gnl|bcl2dbpro|Q925D2_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Rattus norvegicus GN=BIK (length=191 residues).
MASAPVSARTWEFASVPPLGILGSVPFLPRSEDMSEARLMARDIIKTLLHDQVPQPAVVSGAPSMKEPVGVEDVSPVRDL
DFMRCLESRNQVALRLACIGDEMDRCLRSPRLVQLPGIAMHRLAATYSQTGVRGIFRSLIGSLTNLRENIWSWRVFTPGA
WVSPDQDPGQLFPMVLLVFLLLGGAWHLQLQ
>gnl|bcl2dbpro|A0A2K6MCW0_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus bieti GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6QK74_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus roxellana GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6TBD7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BIK (length=155 residues).
MSEDRPLSSDILMETLLCEQFVDPLTMEVVGGSDPEEDPDSVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VATYSPGLAFILDRTDIRDVLSGVVDVFADFQEDIVRLWRSLSSGSWVSGKQAVLLALLALLLAMFSGGLRLLLK
>gnl|bcl2dbpro|A0A673V4V4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Suricata suricatta GN=BIK (length=156 residues).
MTEPNREEMSHAGPLSRDVFLSTFLQEHGPEVLDVPGVTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEMEVRWMVPRVG
ELPGMALYSLAFTYNQTGLRGVLRSLMDGLASLRENIRVWSFLTLRNRVSPNAGRGLALSLLLLVLLLSWGLHHLQ
>gnl|bcl2dbpro|A0A452QUG1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus americanus GN=BIK (length=146 residues).
FHTTRRCAQRVVAPSLHHQHPAGEGAVLTGAGGICQATGPLCNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLA
FTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRVSPHPGRRLVLSLLLLLGLLLGWGFRLLQ
>gnl|bcl2dbpro|A0A452V3L2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Ursus maritimus GN=BIK (length=177 residues).
MAWSSEEARSREEMSHTGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWM
LPRVGELPGMAMYSLAFTYNQTGLRGVLRSLMDGLTNLRENIRIWSFLTFRNRGLDLEPSLPATQPQSRSSRCSDSPPPA
GLVRSCPLPAAPSGPHD
>gnl|bcl2dbpro|A0A3Q7V097_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=185 residues).
MGRWRRGMLLTMFLPKHHSWFSDCEIGRNIPNSREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPN
SNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPN
PGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=251 residues).
MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLLRTPSFTRQLAGIKAGFAELQRNQESSISPFFSSPDGLG
CGRGCSEDGSIRWLGLHADLGEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFI
GDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLV
LLLGWGLRLLQ
© 1998-2022Legal notice