Dataset for protein Puma of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
rkppalhrrplrrvhapgvsvralnprrrrsarpgglpgggdrsaggeqcgrpasphcaspqtprgtlgwgrgegggsal
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
grlvwahrclgglaglftnngvrarqrplaasatpvrtvgvgwrqpppvgwgsgptrrgthtrgrstlrvvtqglvvvvr
                                 mggmrrfppvppgqksprvgpgrmg gclqaprpgpplhl gsrglg
                                    kp da gcae ag g a aaa  aagl aah gaafg  gca e
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------mararqegsspep
ssqglpglvvvltvgfwsgvscvvqrgaspgggpgllcwsrlrgpasgcpcvsppvsrnlsqapgsa-------------
amppagrhprrvssryrrrlrprppgvgrcvwrlskpvvvvatvgvrpmcpqtgrlvstvwvpqqwrgp eqhgprt gg
 gec  cggpprpp epppcplqggcrceg aphddfstrqsmcaqpeawaialwitfstlw chtg      d      
 aa     cmkamc akgaa  acca  c   agacdrrklrlsvpwavv avhqap psas   ic             
         a  ca  a                  a  qgggk slqsrt spclsc lrrm                  
                                      maf g m g ll cg g a cq l                  
                                      g   d   c da        ap                    
                                          a                                     
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
veglardgp---rpfplgrlvpsavscglcepgl------------aapAapallp--aaylcaptappavtaalggprw
---------gprmkagvs----------------ppsgdsmcpapgsrr-crcqv-rassatwvrcqi------------
qlpgpgrs    i---m-pqp g l  srvlrpca           ---g--t--rgtptsv-lllr-hrparrysahtr
    s e     -tcs-parm       sw sd r           ptw rs-rracp-fwrst-qpmvwwvsltrqrse
            vsv a s            a  n           rvq plpcc hgl-vfp-spcvtvgshtsalsli
             r                    s             l ghs f a rv--lrq--trg kd   eq  
                                                v   r a     twfq rs          g  
                                                    g       qp p mh             
                                                            lk c g              
                                                                 a              

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                 :*.  .         
pggprsrprgprp-dgpqPslslaeqhlespvpsa-----PgalaGgPtqaaPGvrgeeeqwareiGAqlRrmAddlnaq
-------------acrsa-rrlp-qt-agg-a-gvagaqr-eg-g-rshpsslespvg----ggav pgdqgpdaadggl
araaplawgsnqgqp---g---srlav---t-e--pqgast--p-q--gvlgd igdqgreqd-tl  ct pv v----r
v  hvwpaaplslssstl gag-p--qe rgqq ihr    msst p --gr  h---r s -qq    f  k rr y -
s  ssrhlpn lfl-e r a at spl   a   e      p  e   qsp   aarrd    pg               
r  fgged a    r       a plt       t                                             
g   e                             h                                             
                                                                                
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                   *            
yeRr-Rqe--------------Eqqrhr------------------------psPwrvlynlim---Gllplprghra--
pqqavsaagecwgrgrrqvglpgrrqaawdfprgrgwrrpspdvrqmlpscc-trpltmegpvqshh tpaftqdpgsgr
----r eg              -tpggl    p g lgaap     lcggaaaa--gl---vfsarr gvdpqgrrwm  
 r t  vs              aghd--                        g- r--agd---    pt cgt-n--  
   s  d                -v-                           g a r  arqv     r   ps-sr  
                        -                                q   mgl     a   k  qk  
                        e                                c   aad            ag  
                                                         a     a             d  
                                                                                
                                                                                

       490       500       510       520       530       540        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
                   .                                                
---------------Pemepn-----------------------------------------------
rahgpaegpaprlarggvgaqtgrsrltrrglgactrpvdvrdlggrplpppdalasaghisctmysr
               addl gktgflcrmgaassvrvcrrpgas r trglrat grgadffrai   
                rtd -a dd aea    pp a p ia g p   e  v  sg dgslq     
                wqa s                 g                             
                 h                                                  
                 a                                                  
                                                                    
                                                                    
                                                                    
© 1998-2020Legal notice