Dataset for protein Puma of organism all

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtvfvmgvrprpvpwvspptmgggcggrargtlgrsrltplhlgrvvvvglsvglrsgpclprvlvrgfksgvpcvprgp
     g cagqga  rpe ag  aa      la pahap     l cfq agp     e a  lgmp        req  
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------k-g-gsa-acpcqvpra-s--wvpcqic----------------g--p----g-----p-p-p----
lsprcccrcecgm-f-v---r---------s-at-------rvlqgprermararqe-ss-epve-lardg-r-f-arpp
            irvsmearqvllgpaaglafspvllhhmrpl  a gsahgprtpg qlrgarr pgprr atl tqs 
            vyctalr wrarwklgptpcvwsstgstq    p hwg   sqad   s  g  wp es s    w  
            ags k   gg mavr epfltvrasvplp    m  t                  s            
              a     m  e sg dstvgsq rrlsh       c                               
              l          g  c lelrh hq pm                                       
                         a  a i rc   n                                          
                                pa   l                                          
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--l-----p-----------l---p------p---a-------p-------------------r-pggp-----------
ga-grlvr-savscglcepg-paa-aapall-rpa-ylcapta-ayvcvstpspavtaalggp-w----rwarvarssrp
   ssvl    sgks w adcrprvgcrprrragpparalllrlsplwtrqlrglahrptrrhlryrphp   a   law
    c m         l s  avngsrdtmcahagltpspvspa  f apdap wwyfcasaswsvpasv       pla
                     s tadghspa g lssvqtsplg          vqrstyhqrthsasll       gps
                     n s  scgcf c   rtlsr t           spagvv tehan ffg        fr
                           mra       s qf s            evhsr  dapd eaa         g
                           gc        h h                lerg  a ia              
                           a         a d                g l     e               
                                                          g                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------gpqpslsp---------aeqhles-------pv---psapgalaggptqaapgvrgee-----eqwareigaq
rgprgpd-------lsgrsppllk-------ggaapgv--ege----------------------hgdqg----------
gsqq qsasr apg-aadpeegeissalalaergqevear   aqrregpgsrshpggsesprgg     gtqdqgvwpg
spsg lpp l trlr         rqpqtqerpvtgarlq   gasamsse p gvlsldigvqa     ra gp kv r
pnnl f t g r re         gvsedwg   s  isg   wrp spms v  hr   hwwrr      e        
a la a s s p pv         etgre t   p  arn    gt  c            ldpd      s        
       r     e           g i          gc     g               a                  
                                       a                                        
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lrrmaddlnaqyerr-rqeEqqrhrpsPwrvLy-------nlimgllplprgtqaPemepn-------------------
----------l----v----trgaaat-plamegggwgrpgpvqshhgtaalhrg-qsprdgaqlgactrpvdvrdsggr
dqgp aadgg-pqqaiqaasrhqrhlar--t--       --fs--yaf-gdrg-gdv---  acprshctgragalttg
n wk yrnyrrtrct  rv ep-----  dlpr       sq--pd--pq-rs-m --qgg         la  a g   
f    r  det   s  t  -- gteg   -           mt scc-h apai wi v          k         
                    ag  vd    f           ll       -n   sr                      
                                           c       p-   rg                      
                                                    g                           
                                                                                
                                                                                

       410       420       430       440    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
plpppdtlasagdflctmaggrrprelraalsraahisqaiysr
traragaas vtnifrpa                          
s         t vsp                             
            gc                              
                                            
                                            
                                            
                                            
                                            
© 1998-2022Legal notice