Dataset for protein Puma of organism all

[Download (right click)] [Alignment] [Repertoires]

51 sequence(s)

>gnl|bcl2dbpro|G1LNV7_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BBC3 (length=152 residues).
GSGARGDPISRPQAQVWKLRPRCVTGGKHRLRGGSEGGGAGRHLPNPSPPGPQPSLSPAEQHLESPVPSAPGALAGGPTQ
AAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A2K5F6X4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Aotus nancymaae GN=BBC3 (length=130 residues).
KCGVGSAWACPCQVPRASSSTWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPGAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A3Q1LXZ6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos taurus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=131 residues).
VRATAEAARACPCQLPGAFFSPWVPHQIRGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEERQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A4W2EKD9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Bos indicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A2R8MW85_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=420 residues).
RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQCGRPASPHCASPQTPRGTLGWGRGEGGGSAL
GRLVWAHRCLGGLAGLFTNNGVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGAATGGGSRAVE
SAAPAGGGCAPATAGYWPRARLAGGAGARGGGGGGCDSGVGRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEP
VEGLARDGPRPFPLGRLVPSAVSCGLCESGLPATPAAPALLPAAYLCAPAAPPAVTAALGGPRWPGGPRSRPRGPRPDGP
QPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQPQHRPSPWRVLYN
LIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2R8MW85_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=131 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A5F4CJ83_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=293 residues).
MQGLPGHVPVRCSGFPSGPVGPPSDLCQARLDVPAPECVPISGPVTRNLLQAPGSAMARARQEGSSPEPVEGLARDGPRP
FPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHL
ESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRVSVGGGVDGRWDFPPGRGLRAAPPDVRQL
LPGAAGSRWGQAGGMGDGPTDLPKGPRRGWHDPGKGRDRLERRGASVALGRGD
>gnl|bcl2dbpro|A0A452E3G1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Capra hircus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLILGLLPFPGGRGAPEVEPN
>gnl|bcl2dbpro|A0A250YBU3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=251 residues).
MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP
RPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQ
HLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQQHRPSPWRVLYNVIMGLLPLP
RGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBU3_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|A0A2K5QNS7_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Cebus capucinus imitator GN=BBC3 (length=131 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAALGVRGEEEQWAREIGAQLQ
RMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K5P2T8_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Cercocebus atys GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRAASATWVLCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A0D9S2H2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BBC3 (length=199 residues).
QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGG
PRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAQEIGAQLRRMADDLNAQYER
RRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A5F5PGZ4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Equus caballus GN=BBC3 (length=131 residues).
VRVSAGAARACLCQAPGASFSPWVPQQTRGPQPSLLPAEQHLESPVPSAPGALEGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRAAPEMEPN
>gnl|bcl2dbpro|A0A337SJI7_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Felis catus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
>gnl|bcl2dbpro|B4DQK3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Homo sapiens GN=BBC3 (length=199 residues).
MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGG
SRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYER
RRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|Q9BXH1_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Homo sapiens GN=BBC3 (length=261 residues).
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGC
RPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGS
PRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|Q9BXH1_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Homo sapiens GN=BBC3 (length=101 residues).
MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|G3T2N1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Loxodonta africana GN=BBC3 (length=186 residues).
MARARQEGSSPEPVEGLARESPRPFPLGSLVPSAVSCGLCEPGLPRVAGPRLLPGPRTQLFPSPSPVWVSDLSGLQLERG
GAEWEDRAPRPLSGPQPSLSPAEQHLESPVPTQAAPGVRGEDEQWAREIGAQFRRKADDLYALYERSVRQEEQHRHRPSP
WRVLYNLIMGLLPLPRDHGAPEMEPN
>gnl|bcl2dbpro|A0A2K5V8J3_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca fascicularis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6ASP2_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Macaca nemestrina GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A1U7R5N5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mesocricetus auratus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRGEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|F7GL32_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Monodelphis domestica GN=BBC3 (length=204 residues).
MARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGG
PRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMSGGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLN
ALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
>gnl|bcl2dbpro|F7GL32_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Monodelphis domestica GN=BBC3 (length=318 residues).
MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRVVFQGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAG
LGKLRRGRARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESPRTFPLGRLMPSAVSCSLCEAGLNP
SGDSMCPAPGPALAPSSLLPLAYFCTRQPRAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEGGQEGEPQGASPMS
GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLISGLLAPQRRNRMPDVEPN
>gnl|bcl2dbpro|B2RVL4_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|Q99ML1_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Mus musculus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|M3Y0R3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Mustela putorius furo GN=BBC3 (length=201 residues).
QAPGSAMARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLWESDCSPRVAAHGLFRAGAAAVSQPPPPPVWVSLT
SQRTIVGGSVGRARGLLFPGPQPSLSPAEPHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALY
ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A2I3HWI8_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Nomascus leucogenys GN=BBC3 (length=107 residues).
MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPS
PWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A5F9DGT6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Oryctolagus cuniculus GN=BBC3 (length=182 residues).
MARARQEGSSPEPVEGLARDGPRPLPAWSPGALGRVLRPSASGKSLLESDCSPRAAAGGLLPASSHSGFPAPLPRPGPPR
PPRGSQLEGGPVTGVVPCPAPRGPLEGVPTPAAPGVWGEEEQWAREIVAQLRWMAYDLYAQYERRQEEQQRHRPSPWRVL
YNLLMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|H0XQ00_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Otolemur garnettii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTATLGGPRWPGG
PRSRPRGPRLDGPQPSLLPAEQHLESPVPSTPGALAGGPTQAAPEVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2R9BZA9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pan paniscus GN=BBC3 (length=131 residues).
MKFGMGSAQACPCQVPRAASVTWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2I3RGH5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pan troglodytes GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2I3RGH5_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Pan troglodytes GN=BBC3 (length=131 residues).
MKFGMGSAQACPCQVPRAASATWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2I3N2Z9_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Papio anubis GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLLLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|H2NZD3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Pongo abelii GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6FQZ1_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=131 residues).
MKFGAGSARACPCQVPGTSFSWWVLGHIPGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6FQZ1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Propithecus coquereli GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|Q80ZG6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rattus norvegicus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
HRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQ
HRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN
>gnl|bcl2dbpro|A0A2K6KS56_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus bieti GN=BBC3 (length=86 residues).
LAERTWSRGASPGALAAPGVAGRRRSGPGIGAQLRRMARRLNAQYRRRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRA
PEMEPN
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6STD6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Saimiri boliviensis boliviensis GN=BBC3 (length=131 residues).
MKCGMGSAWACPCQVPRASSLTWVPCQMCGSQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A480SCP6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=216 residues).
MASGACPISGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAA
YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREI
GAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A480SCP6_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A4X1VVX9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=191 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCATAPAVTAALGGPRWPGGPR
SRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
HRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A4X1VVX9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=130 residues).
ARVSAGAARACPCPVPRAFCSPWPHQIHGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=232 residues).
MVLEGAAAEPALTCSAHLSPQAPRCGMARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPA
PGPALAPPSLLPLAYFCTRQPRSYGGPRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGV
LGPDHGGQAEQQDREIGAQLRRMADDLNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
>gnl|bcl2dbpro|A0A4X2LVY2_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Vombatus ursinus GN=BBC3 (length=206 residues).
MARAQQDGSSREPVEGLPREGPRTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPPSLLPLAYFCTRQPRSYGG
PRWARVARSPAPSSQGQSGSQPSLGERSAEDQEEGGQEVEPQGASPMSGGPPGVLGPDHGGQAEQQDREIGAQLRRMADD
LNALYEQRRREEEQRRHLSPWRLLYNLVSGLLAPHRGNRIPEIEPN
© 1998-2020Legal notice