Dataset for protein Puma of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

44 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      RKPPALHRRPLRRVHAPGVSVRALNPRRRRSARPGGLPGGGDRSAGGEQC
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      GRPASPHCASPQTPRGTLGWGRGEGGGSALGRLVWAHRCLGGLAGLFTNN
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          --------------------------------------------------
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      GVRARQRPLAASATPGKRVDPGVPQPPKSGRGGGAARRGGHTQGARPLGA
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          -------------MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARATGRV
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-01          --------------------------------------------------
F1RM01_BBC3-04          ----------------MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPP
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
F1RM01_BBC3-02          --------------------------------------------------
G1LNV7_BBC3-01          --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-03      ATGGGSRAVESAAPAGGGCAPATAGYWPRARLAGGAGARGGGGGGCDSGV
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
F7GL32_BBC3-01          VFQGLGVGLRSGECAPRLGVRVPCRERGPLSPRCCCRCECGAGLGKLRRG
J9NTK9_BBC3-03          --------------------------------------------------
J9NTK9_BBC3-02          --------------------------------------------------
A0A3Q2GWE8_BBC3-01      ------------------------------------------------VR
Q9BXH1_BBC3-03          ------------------------------------------------MK
J9NTK9_BBC3-01          -----------MQGLPGHVPVRCSGFPSG----------PVGPPSDLCQA
F1RM01_BBC3-04          LHLGLVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDAPCTS
G3T2N1_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-01      -------------------MKLSVGAARACSCQVPRVASCGWAHALFVWS
M3Y0R3_BBC3-01          --------------------------------------------------
A0A1U7R5N5_BBC3-01      --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
A0A250YBU3_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
F1RM01_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
F1RM01_BBC3-02          ----MASGACPISGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP-
G1LNV7_BBC3-01          --GSGARGD-----PISRPQAQ----------------------------
A0A2K5F6X4_BBC3-02      --KCGVGSAWACPCQVPRASSS----------------------------
A0A2R8MW85_BBC3-03      GRLGPPWERACAGLWICRCLAWAPGSAMARARQEGSSPEPVEGLARDGP-
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A3Q2GWE8_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2R8MW85_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          ---------------------------MARAQQDGSSPEPVEGLPRESP-
F7GL32_BBC3-01          RARGVAPPLTCSAHLSVSLRRLPPHWGMARAQQDGSSPEPVEGLPRESP-
J9NTK9_BBC3-03          --------MPCVTPRL-----------GPRERHGPSTPGGQLPGARRGPG
J9NTK9_BBC3-02          --------MPCVTPRL-----------GPRERHGPSTPGGQLPGARRGPG
A0A3Q2GWE8_BBC3-01      VSAGAARACLCQAPGASFSPWVPQQTRGPRERHGPSTPGGQLPGAGRGPG
Q9BXH1_BBC3-03          FGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPG
J9NTK9_BBC3-01          RLDVPAPECVPISGPVTRNLLQAPGSAMARARQEGSSPEPVEGLARDGP-
F1RM01_BBC3-04          QLTVPLCP-----------VLQAPGSAMARARQEGSSPEPVEGLARDGP-
G3T2N1_BBC3-01          ---------------------------MARARQEGSSPEPVEGLARESP-
A0A250YBU3_BBC3-01      LARCAQSGVCPASGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP-
M3Y0R3_BBC3-01          ---------------------QAPGSAMARARQEGSSPEPVEGLSRDGP-
A0A1U7R5N5_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDSP-
Q99ML1_BBC3-02          ---------------------------MARARQEGSSPEPVEGLARDSP-
Q80ZG6_BBC3-01          ---------------------------MARARQEGSSPEPVEGLARDSP-
H0XQ00_BBC3-01          ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A0D9S2H2_BBC3-01      ---------------------QAPGSAMARARQEGSSPEPVEGLARDGP-
B4DQK3_BBC3-01          ---------------------MAPGSAMARARQEGSSPEPVEGLARDGP-
A0A250YBU3_BBC3-02      ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A3Q1LXZ6_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A452E3G1_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGP-
F1RM01_BBC3-03          ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A2I3RGH5_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGP-
H2NZD3_BBC3-01          ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A2K6QZT2_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGP-
A0A2K6FQZ1_BBC3-01      ---------------------------MARARQEGSSPEPVEGLARDGP-
                                                                          

A0A2K6KS56_BBC3-02      --------------------------------------------------
Q9BXH1_BBC3-04          --MKFGMG----------------------------SAQACPCQVPRAAS
F1RM01_BBC3-02          --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPTLLP--AA
G1LNV7_BBC3-01          -------------------------------------------------V
A0A2K5F6X4_BBC3-02      -------------------------------------------------T
A0A2R8MW85_BBC3-03      --RPFPLGRLVPSAVSCGLCESGLP-----------ATPAAPALLP--AA
A0A2I3HWI8_BBC3-03      --MKFGMG----------------------------SARACPCQVPRASS
A0A3Q2GWE8_BBC3-02      --VRVSAG----------------------------AARACLCQAPGASF
A0A2K6STD6_BBC3-02      --MKCGMG----------------------------SAWACPCQVPRASS
A0A2R8MW85_BBC3-02      --MKCGVG----------------------------SAWACPCQVPRASS
A0A2K5QNS7_BBC3-02      --MKCGVG----------------------------SAWACPCQVPRASS
A0A2K6FQZ1_BBC3-04      --MKFGAG----------------------------SARACPCQVPGTSF
A0A2R9BZA9_BBC3-01      --MKFGMG----------------------------SAQACPCQVPRAAS
A0A2I3RGH5_BBC3-03      --MKFGMG----------------------------SAQACPCQVPRAAS
A0A2K5P2T8_BBC3-03      --IKFGVG----------------------------SARACPCQVPRAAS
A0A2K5V8J3_BBC3-03      --IKFGVG----------------------------SARACPCQVPRASS
A0A2K6ASP2_BBC3-03      --IKFGVG----------------------------SARACPCQVPRASS
A0A2I3N2Z9_BBC3-03      --IKFGVG----------------------------SARACPCQVPRASS
A0A2K6QZT2_BBC3-04      --IKFGVG----------------------------SARACPCQVPRASS
F7GL32_BBC3-02          --RTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLP--LA
F7GL32_BBC3-01          --RTFPLGRLMPSAVSCSLCEAGLNPSGDSMCPAPGPALAPSSLLP--LA
J9NTK9_BBC3-03          PRRSAPVSPQPPGAL--GRVLRPLR-----------ARPARRPCCPC-PA
J9NTK9_BBC3-02          PRRSAPVSPQPPGAL--GRVLRPLR-----------ARPARRPCCPC-PA
A0A3Q2GWE8_BBC3-01      PRRPAPLPAQPPGAL--GRVLRPLR-----------ARPARRARRAR-PA
Q9BXH1_BBC3-03          PRRPAPLPARPPGAL--GSVLRPLR-----------ARPGCRPRRPH-PA
J9NTK9_BBC3-01          --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
F1RM01_BBC3-04          --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPTLLP--AA
G3T2N1_BBC3-01          --RPFPLGSLVPSAVSCGLCEPGLP-----------RV-AGPRLLPGPRT
A0A250YBU3_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
M3Y0R3_BBC3-01          --RPFPLSRLVPSAVSCGLWESDCS-----------PRVAAHGLFRAGAA
A0A1U7R5N5_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
Q99ML1_BBC3-02          --RPFPLGRLMPSAVSCSLCEPGLP-----------AAPAAPALLP--AA
Q80ZG6_BBC3-01          --RPFPLGRLMPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
H0XQ00_BBC3-01          --RPFPLGRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
A0A0D9S2H2_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLA-----------AAPAAPALLP--AA
B4DQK3_BBC3-01          --RPFPLGRLVPSAVSCGLCEPGLA-----------AAPAAPTLLP--AA
A0A250YBU3_BBC3-02      --RPFPLGRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
A0A3Q1LXZ6_BBC3-01      --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
A0A452E3G1_BBC3-01      --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
F1RM01_BBC3-03          --RPFPLSRLVPSAVSCGLCEPGLP-----------AAPAAPTLLP--AA
A0A2I3RGH5_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLA-----------AAPAAPTLLP--AA
H2NZD3_BBC3-01          --RPFPLGRLVPSAVSCGLCEPGLA-----------AAPAAPALLP--AA
A0A2K6QZT2_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLA-----------ATPAAPALLP--AA
A0A2K6FQZ1_BBC3-01      --RPFPLGRLVPSAVSCGLCEPGLP-----------AAPAAPALLP--AA
                                                                          

A0A2K6KS56_BBC3-02      --------------LAERTWSRGAS-------------------------
Q9BXH1_BBC3-04          TTWVPCQI--------------------------CETRGAAAAPPLTLEG
F1RM01_BBC3-02          YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
G1LNV7_BBC3-01          WKLRPRCVTGGKHRLRGGSEGGGAGRHLPNPSP-PGPQPSLSPAEQHLES
A0A2K5F6X4_BBC3-02      WVPCQMC----------------------------GPQPSLSLAEQHLES
A0A2R8MW85_BBC3-03      YLCAPAAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
A0A2I3HWI8_BBC3-03      VTWVPCQI--------------------------C---------------
A0A3Q2GWE8_BBC3-02      SPWVPQQT--------------------------RGPQPSLLPAEQHLES
A0A2K6STD6_BBC3-02      LTWVPCQM--------------------------CGSQPSLSLAEQHLES
A0A2R8MW85_BBC3-02      SVWVPCQM--------------------------CGPQPSLSLAEQHLES
A0A2K5QNS7_BBC3-02      SVWVPCQM--------------------------CGPQPSLSLAEQHLES
A0A2K6FQZ1_BBC3-04      SWWVLGHI--------------------------PGPQPSLSLAEQHLES
A0A2R9BZA9_BBC3-01      VTWVPCQI--------------------------CGPQPSLSLAEQHLES
A0A2I3RGH5_BBC3-03      ATWVPCQI--------------------------CGPQPSLSLAEQHLES
A0A2K5P2T8_BBC3-03      ATWVLCQI--------------------------CGPQPSLLLAEQHLES
A0A2K5V8J3_BBC3-03      ATWVPCQI--------------------------CGPQPSLLLAEQHLES
A0A2K6ASP2_BBC3-03      ATWVPCQI--------------------------CGPQPSLLLAEQHLES
A0A2I3N2Z9_BBC3-03      ATWVPCQI--------------------------CGPQPSLLLAEQHLES
A0A2K6QZT2_BBC3-04      ATWVPCQI--------------------------CGPQPSLSLAEQHLES
F7GL32_BBC3-02          YFCTRQP-----RAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEG
F7GL32_BBC3-01          YFCTRQP-----RAYGGPRWARAARSPAAGNQGQSGSLPSLGPRSAQEEG
J9NTK9_BBC3-03          ARCLPLRPHRPARR---HRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGG
J9NTK9_BBC3-02          ARCLPLRPHRPARR---HRRPGGPPLAWGSPQPAPRPAPRRSSALTVAGG
A0A3Q2GWE8_BBC3-01      ARCLPLRPRRPARR---HRRPGGPPLAWGPPQPSPSPAPRRSTALTLAGR
Q9BXH1_BBC3-03          ARCLPLRPHRPTRR---HRRPGGFPLAWGSPQPAPRPAPGRSSALALAGG
J9NTK9_BBC3-01          YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
F1RM01_BBC3-04          YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
G3T2N1_BBC3-01          QLFPSPSPVWVSDLSGLQLERGGAEWEDRAPRPLSGPQPSLSPAEQHLES
A0A250YBU3_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAQQHLES
M3Y0R3_BBC3-01          AVSQPPPPPVWVSLTSQRTIVGGSVGRARGLLF-PGPQPSLSPAEPHLES
A0A1U7R5N5_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAQQHLES
Q99ML1_BBC3-02          YLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP-DGPQPSLSPAQQHLES
Q80ZG6_BBC3-01          YLCAPTAPPAVTAALGGPRWPGGHRSRPRGPRP-DGPQPSLSPAQQHLES
H0XQ00_BBC3-01          YLCAPTAPPAVTATLGGPRWPGGPRSRPRGPRL-DGPQPSLLPAEQHLES
A0A0D9S2H2_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
B4DQK3_BBC3-01          YLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
A0A250YBU3_BBC3-02      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAQQHLES
A0A3Q1LXZ6_BBC3-01      YLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
A0A452E3G1_BBC3-01      YLCAPTAPPAVTAALGAPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
F1RM01_BBC3-03          YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSPAEQHLES
A0A2I3RGH5_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
H2NZD3_BBC3-01          YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
A0A2K6QZT2_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
A0A2K6FQZ1_BBC3-01      YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP-DGPQPSLSLAEQHLES
                                                                          

A0A2K6KS56_BBC3-02      ----------PGAL------AAPGVAGRRRS-GPGIGAQLRRMARRLNAQ
Q9BXH1_BBC3-04          PVQSHHG---TPALTQGPQSPRDGA---------QLGACTRPVDV-----
F1RM01_BBC3-02          PVPSA-----PGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
G1LNV7_BBC3-01          PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A2K5F6X4_BBC3-02      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2R8MW85_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A2I3HWI8_BBC3-03      --------------AGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A3Q2GWE8_BBC3-02      PVPSA-----PGALEGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A2K6STD6_BBC3-02      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2R8MW85_BBC3-02      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A2K5QNS7_BBC3-02      PVPSA-----PGALAGGPTQAALGVRGEEEQWAREIGAQLQRMADDLNAQ
A0A2K6FQZ1_BBC3-04      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2R9BZA9_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2I3RGH5_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K5P2T8_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K5V8J3_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K6ASP2_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2I3N2Z9_BBC3-03      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K6QZT2_BBC3-04      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
F7GL32_BBC3-02          GQEGEPQGASPMS-GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNAL
F7GL32_BBC3-01          GQEGEPQGASPMS-GGPPGVLGPEHGDQGEQQDREIGAQLRRMADDLNAL
J9NTK9_BBC3-03          TAPGIAGAQRPGGPGGRSHPSSPGSPGG----GGAVGPGDRGPAAADGGR
J9NTK9_BBC3-02          TAPGIAGAQRPGGPGGRSHPSSPGSPGG----GGAVGPGDRGPAAADGGR
A0A3Q2GWE8_BBC3-01      AAPGVAGAQRPGGPGGRPHPGSPGSPGG----GGAVGPGDRGPAAADGGR
Q9BXH1_BBC3-03          AAPGVARAQRPGGSGGRSHPGGPGSPRG----GGTVGPGDRGPAAADGGR
J9NTK9_BBC3-01          PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
F1RM01_BBC3-04          PVPSA-----PGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
G3T2N1_BBC3-01          PV---------------PTQAAPGVRGEDEQWAREIGAQFRRKADDLYAL
A0A250YBU3_BBC3-01      PVPSV-----PEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
M3Y0R3_BBC3-01          PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A1U7R5N5_BBC3-01      PVPSA-----PEALAGGPTQAAPGVRGEEEEWAREIGAQLRRMADDLNAQ
Q99ML1_BBC3-02          PVPSA-----PEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQ
Q80ZG6_BBC3-01          PVPSA-----PEALAGGPTQAAPGVRVEEEEWAREIGAQLRRMADDLNAQ
H0XQ00_BBC3-01          PVPST-----PGALAGGPTQAAPEVRGEEEQWAREIGAQLRRMADDLNAQ
A0A0D9S2H2_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAQEIGAQLRRMADDLNAQ
B4DQK3_BBC3-01          PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A250YBU3_BBC3-02      PVPSV-----PEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A3Q1LXZ6_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
A0A452E3G1_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAL
F1RM01_BBC3-03          PVPSA-----PGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
A0A2I3RGH5_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
H2NZD3_BBC3-01          PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K6QZT2_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
A0A2K6FQZ1_BBC3-01      PVPSA-----PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQ
                                                           :*.  .         

A0A2K6KS56_BBC3-02      YRRR-RQE--------------EQQRHR----------------------
Q9BXH1_BBC3-04          -----RDS------------------------------------------
F1RM01_BBC3-02          YERR-RQE--------------EQQRHR----------------------
G1LNV7_BBC3-01          YERR-RQE--------------ERQRHR----------------------
A0A2K5F6X4_BBC3-02      YERR-RQE--------------EQPQHR----------------------
A0A2R8MW85_BBC3-03      YERR-RQE--------------EQPQHR----------------------
A0A2I3HWI8_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A3Q2GWE8_BBC3-02      YERR-RQE--------------EQQRHR----------------------
A0A2K6STD6_BBC3-02      YERR-RQE--------------EQPQHR----------------------
A0A2R8MW85_BBC3-02      YERR-RQE--------------EQPQHR----------------------
A0A2K5QNS7_BBC3-02      YERR-RQE--------------EQPQHR----------------------
A0A2K6FQZ1_BBC3-04      YERR-RQE--------------EQQRHR----------------------
A0A2R9BZA9_BBC3-01      YERR-RQE--------------EQQRHR----------------------
A0A2I3RGH5_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A2K5P2T8_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A2K5V8J3_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A2K6ASP2_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A2I3N2Z9_BBC3-03      YERR-RQE--------------EQQRHR----------------------
A0A2K6QZT2_BBC3-04      YERR-RQE--------------EQQRHR----------------------
F7GL32_BBC3-02          YEQRRREE--------------EQRRHL----------------------
F7GL32_BBC3-01          YEQRRREE--------------EQRRHL----------------------
J9NTK9_BBC3-03          PQRAVRAAGECWGRGRRQVGLPAREGAA----------------------
J9NTK9_BBC3-02          PQRAVRAA--------------ETRGAA----------------------
A0A3Q2GWE8_BBC3-01      PERAVRAA--------------ETRGAA----------------------
Q9BXH1_BBC3-03          PQRTVRAA--------------ETRGAA----------------------
J9NTK9_BBC3-01          YERRVSVG--------------GGVDGRWDFPPGRGLRAAPPDVRQLLPG
F1RM01_BBC3-04          YERRVSAG--------------GGVDGRWDFPRGGGWGRPS----QMCGS
G3T2N1_BBC3-01          YERSVRQE--------------EQHRHR----------------------
A0A250YBU3_BBC3-01      YERR-RQE--------------EQQQHR----------------------
M3Y0R3_BBC3-01          YERR-RQE--------------EQQRHR----------------------
A0A1U7R5N5_BBC3-01      YERR-RQE--------------EQHRHR----------------------
Q99ML1_BBC3-02          YERR-RQE--------------EQHRHR----------------------
Q80ZG6_BBC3-01          YERR-RQE--------------EQHRHR----------------------
H0XQ00_BBC3-01          YERR-RQE--------------EQQRHR----------------------
A0A0D9S2H2_BBC3-01      YERR-RQE--------------EQQRHR----------------------
B4DQK3_BBC3-01          YERR-RQE--------------EQQRHR----------------------
A0A250YBU3_BBC3-02      YERR-RQE--------------EQQQHR----------------------
A0A3Q1LXZ6_BBC3-01      YERR-RQE--------------ERQRHR----------------------
A0A452E3G1_BBC3-01      YERR-RQE--------------ERQRHR----------------------
F1RM01_BBC3-03          YERR-RQE--------------EQQRHR----------------------
A0A2I3RGH5_BBC3-01      YERR-RQE--------------EQQRHR----------------------
H2NZD3_BBC3-01          YERR-RQE--------------EQQRHR----------------------
A0A2K6QZT2_BBC3-01      YERR-RQE--------------EQQRHR----------------------
A0A2K6FQZ1_BBC3-01      YERR-RQE--------------EQQRHR----------------------
                                                                          

A0A2K6KS56_BBC3-02      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
Q9BXH1_BBC3-04          -----------------GGRPLPP---------------------PDTLA
F1RM01_BBC3-02          --PSPWRVLYNLIM---GLLPLPRGRGA-----------------PEMEP
G1LNV7_BBC3-01          --PSPWRVLYNLIM---GLLPLPRGRGA-----------------PEMEP
A0A2K5F6X4_BBC3-02      --PSPWRVLYNLIM---GLLPFPRGHRA-----------------PEMEP
A0A2R8MW85_BBC3-03      --PSPWRVLYNLIM---GLLPFPRGHRA-----------------PEMEP
A0A2I3HWI8_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A3Q2GWE8_BBC3-02      --PSPWRVLYNLIM---GLLPLPRGRAA-----------------PEMEP
A0A2K6STD6_BBC3-02      --PSPWRVLYNLIM---GLLPFPRGHRA-----------------PEMEP
A0A2R8MW85_BBC3-02      --PSPWRVLYNLIM---GLLPFPRGHRA-----------------PEMEP
A0A2K5QNS7_BBC3-02      --PSPWRVLYNLIM---GLLPFPRGHRA-----------------PEMEP
A0A2K6FQZ1_BBC3-04      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2R9BZA9_BBC3-01      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2I3RGH5_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K5P2T8_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K5V8J3_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K6ASP2_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2I3N2Z9_BBC3-03      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K6QZT2_BBC3-04      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
F7GL32_BBC3-02          ---SPWRLLYNLIS---GLLAPQRRNRM-----------------PDVEP
F7GL32_BBC3-01          ---SPWRLLYNLIS---GLLAPQRRNRM-----------------PDVEP
J9NTK9_BBC3-03          --GGPARC--AAAAARRGGVALGTGRWDGRRAHGPAEGPAPRLARPGQGP
J9NTK9_BBC3-02          --ATPPLTLEGPVQSHHGTPALTQGPWS-----------------PGDGA
A0A3Q2GWE8_BBC3-01      --ATPPLALEGPVQSHHGTPAPTQGPSG-----------------PGDGA
Q9BXH1_BBC3-03          --AAPPLTLEGPVQSHHGTPALTQGPQS-----------------PRDGA
J9NTK9_BBC3-01          AAGSRWGQAGGMGD---GPTDLPKGPRR-----------------GWHDP
F1RM01_BBC3-04          CCPARRGRAGDRQV---GGAACPRSHRK-----------------ARAAA
G3T2N1_BBC3-01          --PSPWRVLYNLIM---GLLPLPRDHGA-----------------PEMEP
A0A250YBU3_BBC3-01      --PSPWRVLYNVIM---GLLPLPRGPGA-----------------PEMEP
M3Y0R3_BBC3-01          --PSPWRVLYNLIM---GLLPLPRGRGA-----------------PEMEP
A0A1U7R5N5_BBC3-01      --PSPWRVMYNLFM---GLLPLPRDPGA-----------------PEMEP
Q99ML1_BBC3-02          --PSPWRVMYNLFM---GLLPLPRDPGA-----------------PEMEP
Q80ZG6_BBC3-01          --PSPWRVMYNLFM---GLLPLPRDPGA-----------------PEMEP
H0XQ00_BBC3-01          --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A0D9S2H2_BBC3-01      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
B4DQK3_BBC3-01          --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A250YBU3_BBC3-02      --PSPWRVLYNVIM---GLLPLPRGPGA-----------------PEMEP
A0A3Q1LXZ6_BBC3-01      --PSPWRVLYNLIM---GLLPFPGGRGA-----------------PEVEP
A0A452E3G1_BBC3-01      --PSPWRVLYNLIL---GLLPFPGGRGA-----------------PEVEP
F1RM01_BBC3-03          --PSPWRVLYNLIM---GLLPLPRGRGA-----------------PEMEP
A0A2I3RGH5_BBC3-01      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
H2NZD3_BBC3-01          --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K6QZT2_BBC3-01      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
A0A2K6FQZ1_BBC3-01      --PSPWRVLYNLIM---GLLPLPRGHRA-----------------PEMEP
                                         *                               .

A0A2K6KS56_BBC3-02      N-----------------------------------------------
Q9BXH1_BBC3-04          SAGDFLCTM---------------------------------------
F1RM01_BBC3-02          N-----------------------------------------------
G1LNV7_BBC3-01          N-----------------------------------------------
A0A2K5F6X4_BBC3-02      N-----------------------------------------------
A0A2R8MW85_BBC3-03      N-----------------------------------------------
A0A2I3HWI8_BBC3-03      N-----------------------------------------------
A0A3Q2GWE8_BBC3-02      N-----------------------------------------------
A0A2K6STD6_BBC3-02      N-----------------------------------------------
A0A2R8MW85_BBC3-02      N-----------------------------------------------
A0A2K5QNS7_BBC3-02      N-----------------------------------------------
A0A2K6FQZ1_BBC3-04      N-----------------------------------------------
A0A2R9BZA9_BBC3-01      N-----------------------------------------------
A0A2I3RGH5_BBC3-03      N-----------------------------------------------
A0A2K5P2T8_BBC3-03      N-----------------------------------------------
A0A2K5V8J3_BBC3-03      N-----------------------------------------------
A0A2K6ASP2_BBC3-03      N-----------------------------------------------
A0A2I3N2Z9_BBC3-03      N-----------------------------------------------
A0A2K6QZT2_BBC3-04      N-----------------------------------------------
F7GL32_BBC3-02          N-----------------------------------------------
F7GL32_BBC3-01          N-----------------------------------------------
J9NTK9_BBC3-03          ------------GPPRAPRRVR--GPRPRGLRAALGGAAHISRAIYSR
J9NTK9_BBC3-02          Q----------LGACTRPVDIRDLGGRTLPPPDALASAGDFFCTM---
A0A3Q2GWE8_BBC3-01      Q----------LGACTRPGDVGDLGGRTLPPPDALASAGGSFCTM---
Q9BXH1_BBC3-03          Q----------LGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM---
J9NTK9_BBC3-01          GKGRDRLERRGAS-------------------VALGRGD---------
F1RM01_BBC3-04          GTTGSRARAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYSR
G3T2N1_BBC3-01          N-----------------------------------------------
A0A250YBU3_BBC3-01      N-----------------------------------------------
M3Y0R3_BBC3-01          N-----------------------------------------------
A0A1U7R5N5_BBC3-01      N-----------------------------------------------
Q99ML1_BBC3-02          N-----------------------------------------------
Q80ZG6_BBC3-01          N-----------------------------------------------
H0XQ00_BBC3-01          N-----------------------------------------------
A0A0D9S2H2_BBC3-01      N-----------------------------------------------
B4DQK3_BBC3-01          N-----------------------------------------------
A0A250YBU3_BBC3-02      N-----------------------------------------------
A0A3Q1LXZ6_BBC3-01      N-----------------------------------------------
A0A452E3G1_BBC3-01      N-----------------------------------------------
F1RM01_BBC3-03          N-----------------------------------------------
A0A2I3RGH5_BBC3-01      N-----------------------------------------------
H2NZD3_BBC3-01          N-----------------------------------------------
A0A2K6QZT2_BBC3-01      N-----------------------------------------------
A0A2K6FQZ1_BBC3-01      N-----------------------------------------------
                                                                        

© 1998-2020Legal notice