Dataset for protein Puma of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

82 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GL32_BBC3-01          -----MGVRPRGAPWRPEPAGGGGAGGRARGTAGRARAT----GRVVFQG
A0A480SCP6_BBC3-04      MTVFVGGCAGQPVPWVSPPTMGGAC------LLGPSHLPPLHLGLVCVVG
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      --------------------------------------------------
A0A2K5F6X4_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-02      --------------------------------------------------
A0A671F3X5_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------------------
A0A2I3N2Z9_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-03          --------------------------------------------------
A0A2I3RGH5_BBC3-02      --------------------------------------------------
H2NZD3_BBC3-01          --------------------------------------------------
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
                                                                          

F7GL32_BBC3-01          LGVGLRSGECAPRLGVR-----VPCRERGPLSPRCCCRCECGAGLGKLRR
A0A480SCP6_BBC3-04      ASPGL---PCLPRVLMPGFKSGVPCVPQG---------------------
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K5F6X4_BBC3-01      -------------------------------------------KCGVGSA
A0A673UKJ9_BBC3-02      ------------------------------------------MYSSAGAA
A0A2K6FQZ1_BBC3-03      ------------------------------------------MKFGAGSA
A0A671F3X5_BBC3-03      -------------------------------------------RVSAGAA
A0A2K6STD6_BBC3-01      ------------------------------------------MKCGMGSA
A0A2K5P2T8_BBC3-02      ------------------------------------------IKFGVGSA
A0A2K6ASP2_BBC3-02      ------------------------------------------IKFGVGSA
A0A2K6QZT2_BBC3-03      ------------------------------------------IKFGVGSA
A0A2K5QNS7_BBC3-03      ------------------------------------------MKCGVGSA
A0A2I3HWI8_BBC3-01      ------------------------------------------MKFGMGSA
Q9BXH1_BBC3-04          ------------------------------------------MKFGMGSA
A0A2R9BZA9_BBC3-02      ------------------------------------------MKFGMGSA
A0A2I3RGH5_BBC3-05      ------------------------------------------MKFGMGSA
A0A2K5F6X4_BBC3-02      -------------------------------------------KCGVGSA
A0A673UKJ9_BBC3-01      ------------------------------------------MYSSAGAA
A0A480SCP6_BBC3-01      ------------------------------------------ARVSAGAA
A0A4X1VVX9_BBC3-01      ------------------------------------------ARVSAGAA
A0A2K5V8L0_BBC3-01      ------------------------------------------IKFGVGSA
A0A2I3HWI8_BBC3-03      ------------------------------------------MKFGMGSA
A0A671F3X5_BBC3-02      -------------------------------------------RVSAGAA
A0A4W2EKD9_BBC3-01      ------------------------------------------VRATAEAA
A0A4W2EKD9_BBC3-01      ------------------------------------------VRATAEAA
A0A5F5PGZ4_BBC3-02      ------------------------------------------VRVSAGAA
A0A2K5QNS7_BBC3-02      ------------------------------------------MKCGVGSA
A0A2K6STD6_BBC3-02      ------------------------------------------MKCGMGSA
A0A2K6FQZ1_BBC3-04      ------------------------------------------MKFGAGSA
H2NZD3_BBC3-02          ------------------------------------------MKFGMGSA
Q9BXH1_BBC3-05          ------------------------------------------MKFGMGSA
A0A2R9BZA9_BBC3-01      ------------------------------------------MKFGMGSA
A0A2I3RGH5_BBC3-03      ------------------------------------------MKFGMGSA
A0A2K5P2T8_BBC3-03      ------------------------------------------IKFGVGSA
A0A2K6ASP2_BBC3-03      ------------------------------------------IKFGVGSA
A0A2I3N2Z9_BBC3-02      ------------------------------------------IKFGVGSA
A0A2K6QZT2_BBC3-04      ------------------------------------------IKFGVGSA
F7GL32_BBC3-02          --------------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------------
A0A2K6KS56_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-04      ------------------------------------------MKFGMGSA
A0A2K5F6X4_BBC3-03      ------------------------------------------------SA
A0A2K6FQZ1_BBC3-02      ------------------------------------------MKFGAGSA
A0A671F3X5_BBC3-01      -------------------------------------------RVSAGAA
A0A5F5PGZ4_BBC3-01      ------------------------------------------VRVSAGAA
A0A2I3HWI8_BBC3-02      ------------------------------------------MKFGMGSA
A0A2K5QNS7_BBC3-01      ------------------------------------------MKCGVGSA
A0A2K5P2T8_BBC3-01      ------------------------------------------IKFGVGSA
A0A2K6QZT2_BBC3-02      ------------------------------------------IKFGVGSA
A0A2K6ASP2_BBC3-01      ------------------------------------------IKFGVGSA
A0A2I3N2Z9_BBC3-01      ------------------------------------------IKFGVGSA
Q9BXH1_BBC3-03          ------------------------------------------MKFGMGSA
A0A2I3RGH5_BBC3-02      ------------------------------------------MKFGMGSA
H2NZD3_BBC3-01          ------------------------------------------MKFGMGSA
M3Y0R3_BBC3-01          --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------------
                                                                          

F7GL32_BBC3-01          GRARGVAPPLTCSAHLSVSLRRL--PPHWGMARAQQDGSSPEPVEGLPRE
A0A480SCP6_BBC3-04      GGCPGGRPDAPCTSQLTVPLCPVLQAPGSAMARARQEGSSPEPVEGLARD
A0A2K6KS56_BBC3-02      ---------LAERTW-----------------------------------
A0A2K5F6X4_BBC3-01      WACPCQVPRASSSTWVPCQMC-----------------------------
A0A673UKJ9_BBC3-02      RACPWKV-GASLVPRVPRQIC-----------------------------
A0A2K6FQZ1_BBC3-03      RACPCQVPGTSFSWWVLGHIP-----------------------------
A0A671F3X5_BBC3-03      RACPCQVPRLPSG-WVPHQIC-----------------------------
A0A2K6STD6_BBC3-01      WACPCQVPRASSLTWVPCQMC-----------------------------
A0A2K5P2T8_BBC3-02      RACPCQVPRAASATWVLCQIC-----------------------------
A0A2K6ASP2_BBC3-02      RACPCQVPRASSATWVPCQIC-----------------------------
A0A2K6QZT2_BBC3-03      RACPCQVPRASSATWVPCQIC-----------------------------
A0A2K5QNS7_BBC3-03      WACPCQVPRASSSVWVPCQMC-----------------------------
A0A2I3HWI8_BBC3-01      RACPCQVPRASSVTWVPCQIC-----------------------------
Q9BXH1_BBC3-04          QACPCQVPRAASTTWVPCQIC-----------------------------
A0A2R9BZA9_BBC3-02      QACPCQVPRAASVTWVPCQIC-----------------------------
A0A2I3RGH5_BBC3-05      QACPCQVPRAASATWVPCQIC-----------------------------
A0A2K5F6X4_BBC3-02      WACPCQVPRASSSTWVPCQMC-----------------------------
A0A673UKJ9_BBC3-01      RACPWKVGASLVPRV-PRQIC-----------------------------
A0A480SCP6_BBC3-01      RACPCPVPRAFCSPW-PHQIH-----------------------------
A0A4X1VVX9_BBC3-01      RACPCPVPRAFCSPW-PHQIH-----------------------------
A0A2K5V8L0_BBC3-01      RACPCQVPRASSATWVPCQIC-----------------------------
A0A2I3HWI8_BBC3-03      RACPCQVPRASSVTWVPCQIC-----------------------------
A0A671F3X5_BBC3-02      RACPCQVPRLPSG-WVPHQIC-----------------------------
A0A4W2EKD9_BBC3-01      RACPCQLPGAFFSPWVPHQIR-----------------------------
A0A4W2EKD9_BBC3-01      RACPCQLPGAFFSPWVPHQIR-----------------------------
A0A5F5PGZ4_BBC3-02      RACLCQAPGASFSPWVPQQTR-----------------------------
A0A2K5QNS7_BBC3-02      WACPCQVPRASSSVWVPCQMC-----------------------------
A0A2K6STD6_BBC3-02      WACPCQVPRASSLTWVPCQMC-----------------------------
A0A2K6FQZ1_BBC3-04      RACPCQVPGTSFSWWVLGHIP-----------------------------
H2NZD3_BBC3-02          QACPCQVPRASSATWVPCQIC-----------------------------
Q9BXH1_BBC3-05          QACPCQVPRAASTTWVPCQIC-----------------------------
A0A2R9BZA9_BBC3-01      QACPCQVPRAASVTWVPCQIC-----------------------------
A0A2I3RGH5_BBC3-03      QACPCQVPRAASATWVPCQIC-----------------------------
A0A2K5P2T8_BBC3-03      RACPCQVPRAASATWVLCQIC-----------------------------
A0A2K6ASP2_BBC3-03      RACPCQVPRASSATWVPCQIC-----------------------------
A0A2I3N2Z9_BBC3-02      RACPCQVPRASSATWVPCQIC-----------------------------
A0A2K6QZT2_BBC3-04      RACPCQVPRASSATWVPCQIC-----------------------------
F7GL32_BBC3-02          ------------------------------MARAQQDGSSPEPVEGLPRE
A0A4X2LVY2_BBC3-01      MVLEGAAAEPALTCSAHLSPQ----APRCGMARAQQDGSSREPVEGLPRE
A0A4X2LVY2_BBC3-02      ------------------------------MARAQQDGSSREPVEGLPRE
A0A2K6KS56_BBC3-01      -------------------------MPRTR-------GSSPGPVEGW-PR
A0A2I3RGH5_BBC3-04      QACPCQVPRAASATWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2K5F6X4_BBC3-03      WACPCQVPRASSSTWVPCQMC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2K6FQZ1_BBC3-02      RACPCQVPGTSFSWWVLGHIP----GPRERHGPRTPGGQLPGARRGPGPR
A0A671F3X5_BBC3-01      RACPCQVPRLPSG-WVPHQIC----GPRERHGPSTPGGQLPGARRGPGPR
A0A5F5PGZ4_BBC3-01      RACLCQAPGASFSPWVPQQTR----GPRERHGPSTPGGQLPGAGRGPGPR
A0A2I3HWI8_BBC3-02      RACPCQVPRASSVTWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2K5QNS7_BBC3-01      WACPCQVPRASSSVWVPCQMC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2K5P2T8_BBC3-01      RACPCQVPRAASATWVLCQIC----GPRERHGPRTPGGQLSGARRGPGPR
A0A2K6QZT2_BBC3-02      RACPCQVPRASSATWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2K6ASP2_BBC3-01      RACPCQVPRASSATWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2I3N2Z9_BBC3-01      RACPCQVPRASSATWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
Q9BXH1_BBC3-03          QACPCQVPRAASTTWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
A0A2I3RGH5_BBC3-02      QACPCQVPRAASATWVPCQIC----GPRERHGPRTPGGQLPGARRGPGPR
H2NZD3_BBC3-01          QACPCQVPRASSATWVPCQIC----GPRERHGPRTAGGQLPGARRGPGPR
M3Y0R3_BBC3-01          --------------------Q----APGSAMARARQEGSSPEPVEGLSRD
B2RVL4_BBC3-01          ------------------------------MARARQEGSSPEPVEGLARD
Q99ML1_BBC3-02          ------------------------------MARARQEGSSPEPVEGLARD
Q80ZG6_BBC3-01          ------------------------------MARARQEGSSPEPVEGLARD
H0XQ00_BBC3-01          ------------------------------MARARQEGSSPEPVEGLARD
A0A4X1VVX9_BBC3-02      ------------------------------MARARQEGSSPEPVEGLARD
A0A4W2EKD9_BBC3-02      ------------------------------MARARQEGSSPEPVEGLARD
A0A3Q1LXZ6_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A4W2EKD9_BBC3-02      ------------------------------MARARQEGSSPEPVEGLARD
A0A452E3G1_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A2Y9PEE3_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A337SJI7_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A667IM83_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A480SCP6_BBC3-03      ------------------------------MARARQEGSSPEPVEGLARD
A0A2K6FQZ1_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
Q9BXH1_BBC3-06          ------------------------------MARARQEGSSPEPVEGLARD
A0A2I3RGH5_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A2K6QZT2_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A0D9S2H2_BBC3-01      --------------------Q----APGSAMARARQEGSSPEPVEGLARD
B4DQK3_BBC3-01          --------------------M----APGSAMARARQEGSSPEPVEGLARD
Q99ML1_BBC3-01          ------------------------------MARARQEGSSPEPVEGLARD
Q99ML1_BBC3-03          ------------------------------MARARQEGSSPEPVEGLARD
G3T2N1_BBC3-01          ------------------------------MARARQEGSSPEPVEGLARE
A0A5F9DGT6_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
A0A480SCP6_BBC3-02      ---MASGACPISGPVSRNLSQ----APGSAMARARQEGSSPEPVEGLARD
A0A7N5KJL4_BBC3-02      ------------------------------MARARQEGSSPEPVEGLARD
A0A7N5KJL4_BBC3-01      ------------------------------MARARQEGSSPEPVEGLARD
                                                                          

F7GL32_BBC3-01          SPRTFP------LGRLM-PSAVSCSLCEAGLNPSGDSMCPAPGPALAPSS
A0A480SCP6_BBC3-04      GPRPFP------LSRLV-PSAVSCGLCEPGL----------PAAPAAP-T
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
F7GL32_BBC3-02          SPRTFP------LGRLM-PSAVSCSLCEAGL--NPSGDSMCPAPGPALAP
A0A4X2LVY2_BBC3-01      GPRTFP------LGRLM-PSAVSCSLCEAGL--NPSGDSMCPAPGPALAP
A0A4X2LVY2_BBC3-02      GPRTFP------LGRLM-PSAVSCSLCEAGL--NPSGDSMCPAPGPALAP
A0A2K6KS56_BBC3-01      RPSPLPARP------VLRP-----------LRARPAAAPAAPA-LLARLP
A0A2I3RGH5_BBC3-04      RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPH-PAARCL
A0A2K5F6X4_BBC3-03      RPAPLP---------------------------------------AAACD
A0A2K6FQZ1_BBC3-02      RPAPLPARPPGALGRVLRP-----------LRARPARCPRRPR-PATRCL
A0A671F3X5_BBC3-01      RPAPLPTQPPGALGCVLRP-----------LRARPARCPRRPC-PAASCL
A0A5F5PGZ4_BBC3-01      RPAPLPAQPPGALGRVLRP-----------LRARPARRARRAR-PAARCL
A0A2I3HWI8_BBC3-02      RPAPLPARPPGALGSVLRP-----------LRARPSCRPRRPR-PAARCL
A0A2K5QNS7_BBC3-01      RPAPLPARPPGALGRVLRP-----------LRVRPARRPCRPR-LAARCL
A0A2K5P2T8_BBC3-01      RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPR-PAARCL
A0A2K6QZT2_BBC3-02      RPAPLPARPPGALGSVLRP-----------LRARPGCHPRCPR-PAARCL
A0A2K6ASP2_BBC3-01      RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPR-PAARCL
A0A2I3N2Z9_BBC3-01      RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPR-PAARCL
Q9BXH1_BBC3-03          RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPH-PAARCL
A0A2I3RGH5_BBC3-02      RPAPLPARPPGALGSVLRP-----------LRARPGCRPRRPH-PAARCL
H2NZD3_BBC3-01          RPAPLPARPPGALGSVLRP-----------LRARPGRRPRRPR-PAARCL
M3Y0R3_BBC3-01          GPRPFP------LSRLV-PSAVSCGLWESDCSPRVAAHGLFRAGAAAVSQ
B2RVL4_BBC3-01          SPRPFP------LGRLM-PSAVSCSLCEPGLPAAPAAPALLP--AAYLCA
Q99ML1_BBC3-02          SPRPFP------LGRLM-PSAVSCSLCEPGLPAAPAAPALLP--AAYLCA
Q80ZG6_BBC3-01          SPRPFP------LGRLM-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
H0XQ00_BBC3-01          GPRPFP------LGRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A4X1VVX9_BBC3-02      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPTLLP--AAYLCA
A0A4W2EKD9_BBC3-02      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A3Q1LXZ6_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A4W2EKD9_BBC3-02      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A452E3G1_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A2Y9PEE3_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A337SJI7_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A667IM83_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
A0A480SCP6_BBC3-03      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPTLLP--AAYLCA
A0A2K6FQZ1_BBC3-01      GPRPFP------LGRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCA
Q9BXH1_BBC3-06          GPRPFP------LGRLV-PSAVSCGLCEPGLAAAPAAPTLLP--AAYLCA
A0A2I3RGH5_BBC3-01      GPRPFP------LGRLV-PSAVSCGLCEPGLAAAPAAPTLLP--AAYLCA
A0A2K6QZT2_BBC3-01      GPRPFP------LGRLV-PSAVSCGLCEPGLAATPAAPALLP--AAYLCA
A0A0D9S2H2_BBC3-01      GPRPFP------LGRLV-PSAVSCGLCEPGLAAAPAAPALLP--AAYLCA
B4DQK3_BBC3-01          GPRPFP------LGRLV-PSAVSCGLCEPGLAAAPAAPTLLP--AAYLCA
Q99ML1_BBC3-01          SPRPFP------LGRLM-PSAVSCSLCEPGLPAAPAAPALLP--AAYLCA
Q99ML1_BBC3-03          SPRPFP------LGRLM-PSAVSCSLCEPGLPAAPAAPALLP--AAYLCA
G3T2N1_BBC3-01          SPRPFP------LGSLV-PSAVSCGLCEPGLP-RVAGPRLLP--GPRTQL
A0A5F9DGT6_BBC3-01      GPRPLPAWSPGALGRVLRPSASGKSLLESDCSPRAAAGGLLP--ASSH--
A0A480SCP6_BBC3-02      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPTLLP--AAYLCA
A0A7N5KJL4_BBC3-02      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYL--
A0A7N5KJL4_BBC3-01      GPRPFP------LSRLV-PSAVSCGLCEPGLPAAPAAPALLP--AAYLCH
                                                                          

F7GL32_BBC3-01          LLPLAYFCTRQPR-----AYGGPRWARAAR-------SPAAGNQGQSGSL
A0A480SCP6_BBC3-04      LLPAAYLCAPTAPPAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A2K6KS56_BBC3-02      --------------------------------------------------
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K5F6X4_BBC3-02      -----------------------------------------------GPQ
A0A673UKJ9_BBC3-01      -----------------------------------------------GPQ
A0A480SCP6_BBC3-01      -----------------------------------------------GPQ
A0A4X1VVX9_BBC3-01      -----------------------------------------------GPQ
A0A2K5V8L0_BBC3-01      -----------------------------------------------GPQ
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-02      -----------------------------------------------GPQ
A0A4W2EKD9_BBC3-01      -----------------------------------------------GPQ
A0A4W2EKD9_BBC3-01      -----------------------------------------------GPQ
A0A5F5PGZ4_BBC3-02      -----------------------------------------------GPQ
A0A2K5QNS7_BBC3-02      -----------------------------------------------GPQ
A0A2K6STD6_BBC3-02      -----------------------------------------------GSQ
A0A2K6FQZ1_BBC3-04      -----------------------------------------------GPQ
H2NZD3_BBC3-02          -----------------------------------------------GPQ
Q9BXH1_BBC3-05          -----------------------------------------------GPQ
A0A2R9BZA9_BBC3-01      -----------------------------------------------GPQ
A0A2I3RGH5_BBC3-03      -----------------------------------------------GPQ
A0A2K5P2T8_BBC3-03      -----------------------------------------------GPQ
A0A2K6ASP2_BBC3-03      -----------------------------------------------GPQ
A0A2I3N2Z9_BBC3-02      -----------------------------------------------GPQ
A0A2K6QZT2_BBC3-04      -----------------------------------------------GPQ
F7GL32_BBC3-02          SSLL---------PLAYFCTRQPRAYGGPRWARAARSPAAGNQG-QSGSL
A0A4X2LVY2_BBC3-01      PSLL---------PLAYFCTRQPRSYGGPRWARVARSPAPSSQG-QSGSQ
A0A4X2LVY2_BBC3-02      PSLL---------PLAYFCTRQPRSYGGPRWARVARSPAPSSQG-QSGSQ
A0A2K6KS56_BBC3-01      PLRP------------HRP----RRPAPPL-------GRWPGPA-A-APG
A0A2I3RGH5_BBC3-04      PLRP------------HRPTRRHRRPGGSP-------LAWGSPQ-P-APR
A0A2K5F6X4_BBC3-03      VSPP------------AATRRTAAWPRGLG----------GSPQ-P-PPR
A0A2K6FQZ1_BBC3-02      PLRP------------HRPARRHRRPGGPP-------LAWGSPQ-P-TPR
A0A671F3X5_BBC3-01      PLRP------------HSPAHRHLHPGGPP-------LAWGSPQ-P-APR
A0A5F5PGZ4_BBC3-01      PLRP------------RRPARRHRRPGGPP-------LAWGPPQ-P-SPS
A0A2I3HWI8_BBC3-02      PLRP------------HRSTRRHRRPGGPP-------LARGSSQ-P-APR
A0A2K5QNS7_BBC3-01      PLRP------------RHPTRRHRRPGEPP-------LAWGPPQ-P-PPR
A0A2K5P2T8_BBC3-01      PLRP------------HRPTRRHRRPGGPP-------LAWGSPQ-P-APR
A0A2K6QZT2_BBC3-02      PLRP------------HRPTRRHRRPGGPP-------LAWGSPQ-P-APR
A0A2K6ASP2_BBC3-01      PLRP------------HRPTRRHRHPGGPP-------LAWGSPQ-P-APR
A0A2I3N2Z9_BBC3-01      PLRP------------HRPTRRHRRPGGPP-------LAWGSPQ-P-APR
Q9BXH1_BBC3-03          PLRP------------HRPTRRHRRPGGFP-------LAWGSPQ-P-APR
A0A2I3RGH5_BBC3-02      PLRP------------HRPTRRHRRPGGSP-------LAWGSPQ-P-APR
H2NZD3_BBC3-01          PLRP------------HRPTRRHRRPGGPP-------LAGGSPQ-P-APR
M3Y0R3_BBC3-01          PPPP---------PVWVSLTSQRTIVGGSV-------GRARGLL-FPGPQ
B2RVL4_BBC3-01          PTAP---------PAVTAALGGPRWPGGHR-------SRPRGPR-PDGPQ
Q99ML1_BBC3-02          PTAP---------PAVTAALGGPRWPGGHR-------SRPRGPR-PDGPQ
Q80ZG6_BBC3-01          PTAP---------PAVTAALGGPRWPGGHR-------SRPRGPR-PDGPQ
H0XQ00_BBC3-01          PTAP---------PAVTATLGGPRWPGGPR-------SRPRGPR-LDGPQ
A0A4X1VVX9_BBC3-02      --TA---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A4W2EKD9_BBC3-02      PTAP---------PAVTAALGAPRWPGGPR-------SRPRGPR-PDGPQ
A0A3Q1LXZ6_BBC3-01      PTAP---------PAVTAALGAPRWPGGPR-------SRPRGPR-PDGPQ
A0A4W2EKD9_BBC3-02      PTAP---------PAVTAALGAPRWPGGPR-------SRPRGPR-PDGPQ
A0A452E3G1_BBC3-01      PTAP---------PAVTAALGAPRWPGGPR-------SRPRGPR-PDGPQ
A0A2Y9PEE3_BBC3-01      PTAP---------PAVTAALGAPRWPGGPR-------SRPRGPR-PDGPQ
A0A337SJI7_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A667IM83_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A480SCP6_BBC3-03      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A2K6FQZ1_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
Q9BXH1_BBC3-06          PTAP---------PAVTAALGGSRWPGGPR-------SRPRGPR-PDGPQ
A0A2I3RGH5_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A2K6QZT2_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A0D9S2H2_BBC3-01      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
B4DQK3_BBC3-01          PTAP---------PAVTAALGGSRWPGGPR-------SRPRGPR-PDGPQ
Q99ML1_BBC3-01          PTAP---------PAVTAALGGPRWPGGHR-------SRPRGPR-PD---
Q99ML1_BBC3-03          PTAP---------PAVTAALGGPRWPGGHR-------SRPRGPR-PDGPQ
G3T2N1_BBC3-01          FPSPSPVWVSDLSGLQLERGGAEWEDRAPR-------PLS-------GPQ
A0A5F9DGT6_BBC3-01      -------------------------SGFPA-------PLP-------RPG
A0A480SCP6_BBC3-02      PTAP---------PAVTAALGGPRWPGGPR-------SRPRGPR-PDGPQ
A0A7N5KJL4_BBC3-02      --------------WPAGVVGADHAPPPPR-------LFP-------GPQ
A0A7N5KJL4_BBC3-01      RLRG---------GSEGGGAGRHLPNPSP----------P-------GPQ
                                                                          

F7GL32_BBC3-01          PSLGP---------RSAQEEG-------GQEGEPQGASPMSGGP----PG
A0A480SCP6_BBC3-04      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6KS56_BBC3-02      ----------------------------SR---GASPGAL------AAPG
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A2K6FQZ1_BBC3-03      --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A2K6STD6_BBC3-01      --------------------------------------------------
A0A2K5P2T8_BBC3-02      --------------------------------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
Q9BXH1_BBC3-04          --------------------------------------------------
A0A2R9BZA9_BBC3-02      --------------------------------------------------
A0A2I3RGH5_BBC3-05      --------------------------------------------------
A0A2K5F6X4_BBC3-02      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A673UKJ9_BBC3-01      PSLSP---------AEPHLES-------PV---PSAPGALAGGPTQAAPG
A0A480SCP6_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A4X1VVX9_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K5V8L0_BBC3-01      PSLLL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2I3HWI8_BBC3-03      ----------------------------------------AGGPTQAAPG
A0A671F3X5_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTHAAPG
A0A4W2EKD9_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A4W2EKD9_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A5F5PGZ4_BBC3-02      PSLLP---------AEQHLES-------PV---PSAPGALEGGPTQAAPG
A0A2K5QNS7_BBC3-02      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAALG
A0A2K6STD6_BBC3-02      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6FQZ1_BBC3-04      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
H2NZD3_BBC3-02          PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
Q9BXH1_BBC3-05          PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2R9BZA9_BBC3-01      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2I3RGH5_BBC3-03      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K5P2T8_BBC3-03      PSLLL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6ASP2_BBC3-03      PSLLL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2I3N2Z9_BBC3-02      PSLLL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6QZT2_BBC3-04      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
F7GL32_BBC3-02          PSLGP---------RSA--QEEGGQEGEPQ---GASPMS-GGPPGVLGPE
A0A4X2LVY2_BBC3-01      PSLGE---------RSAEDQEEGGQEVEPQ---GASPMS-GGPPGVLGPD
A0A4X2LVY2_BBC3-02      PSLGE---------RSAEDQEEGGQEVEPQ---GASPMS-GGPPGVLGPD
A0A2K6KS56_BBC3-01      PRPEVSARPPPGLIGVGRTWSRGASPGALA---GGPPGGPGSR-------
A0A2I3RGH5_BBC3-04      PAPGRAGDSEELEKSSALALAGGAAPGVAR---AQRPGGSGGRSHPGGPG
A0A2K5F6X4_BBC3-03      PAPGR---------E--------GPEARRN---WRRPGGPGGRSHPGGPG
A0A2K6FQZ1_BBC3-02      PAPGR---------SSAITLAGRAAPGVAR---PQRPGGPGGRSHPGGPG
A0A671F3X5_BBC3-01      PAPRR---------SSALTLTRGAAPGIAG---AQRPGCPGGRPHPRSPG
A0A5F5PGZ4_BBC3-01      PAPRR---------STALTLAGRAAPGVAG---AQRPGGPGGRPHPGSPG
A0A2I3HWI8_BBC3-02      PAPGR---------R---------------------------RSHPGGSG
A0A2K5QNS7_BBC3-01      PAPGR---------SSALALAGGAAPGVAR---AQRPGGPGGRSHPGGPG
A0A2K5P2T8_BBC3-01      PTPGR---------SSALALAGGAAPGVAR---AQRPGGPGGRSHPGGPG
A0A2K6QZT2_BBC3-02      PTPGR---------SSALALAGGAAPGVAG---AQRPGGPGGRSHPGGPG
A0A2K6ASP2_BBC3-01      PTPGR---------SSALALAGGAAPGVAR---AQRPGGPGGRSHPGGPG
A0A2I3N2Z9_BBC3-01      PTPGR---------SSALALAGGAAPGVAR---AQRPGGPGGRSHPGGPG
Q9BXH1_BBC3-03          PAPGR---------SSALALAGGAAPGVAR---AQRPGGSGGRSHPGGPG
A0A2I3RGH5_BBC3-02      PAPGR---------SSALALAGGAAPGVAR---AQRPGGSGGRSHPGGPG
H2NZD3_BBC3-01          PAPGR---------SSALALAGGAAPGVAR---AQRPGGSGGRSHPGGPG
M3Y0R3_BBC3-01          PSLSP---------AEPHLES-------PV---PSAPGALAGGPTQAAPG
B2RVL4_BBC3-01          PSLSP---------AQQHLES-------PV---PSAPEALAGGPTQAAPG
Q99ML1_BBC3-02          PSLSP---------AQQHLES-------PV---PSAPEALAGGPTQAAPG
Q80ZG6_BBC3-01          PSLSP---------AQQHLES-------PV---PSAPEALAGGPTQAAPG
H0XQ00_BBC3-01          PSLLP---------AEQHLES-------PV---PSTPGALAGGPTQAAPE
A0A4X1VVX9_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A4W2EKD9_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A3Q1LXZ6_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A4W2EKD9_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A452E3G1_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2Y9PEE3_BBC3-01      PSLSP---------AEQHLES-------LV---PSAPGALAGGPTQAAPG
A0A337SJI7_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A667IM83_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A480SCP6_BBC3-03      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6FQZ1_BBC3-01      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
Q9BXH1_BBC3-06          PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2I3RGH5_BBC3-01      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A2K6QZT2_BBC3-01      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A0D9S2H2_BBC3-01      PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
B4DQK3_BBC3-01          PSLSL---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          PSLSP---------AQQHLES-------PV---PSAPEALAGGPTQAAPG
G3T2N1_BBC3-01          PSLSP---------AEQHLES-------PV-------------PTQAAPG
A0A5F9DGT6_BBC3-01      PPRPP---------RGSQLEGGPVTGVVPC---PAPRGPLEGVPTPAAPG
A0A480SCP6_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A7N5KJL4_BBC3-02      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
A0A7N5KJL4_BBC3-01      PSLSP---------AEQHLES-------PV---PSAPGALAGGPTQAAPG
                                                                          

F7GL32_BBC3-01          VLGPEHGDQGEQQDREIGAQLRRMADDLNALYEQR-RREEEQRRHLSPWR
A0A480SCP6_BBC3-04      IRGEE-----EQWAREIGAQLRRMADDLNALYE---RRVSAGGGVDGRWD
A0A2K6KS56_BBC3-02      VAGRR-----RS-GPGIGAQLRRMARRLNAQYRRR-RQEEQQRHRPSPWR
A0A2K5F6X4_BBC3-01      ---------------------------------------ETRGAAAAPPL
A0A673UKJ9_BBC3-02      ---------------------------------------ETRGAAATPPL
A0A2K6FQZ1_BBC3-03      ---------------------------------------ETRGAAETPPL
A0A671F3X5_BBC3-03      ---------------------------------------ETRGAAATPPL
A0A2K6STD6_BBC3-01      ---------------------------------------ETRRAAATPPL
A0A2K5P2T8_BBC3-02      ---------------------------------------ETRGAAATPPL
A0A2K6ASP2_BBC3-02      ---------------------------------------ETRGAAATPPL
A0A2K6QZT2_BBC3-03      ---------------------------------------ETRGAAATPPL
A0A2K5QNS7_BBC3-03      ---------------------------------------ETRGAAAAPPL
A0A2I3HWI8_BBC3-01      ---------------------------------------ETRGATAAPPL
Q9BXH1_BBC3-04          ---------------------------------------ETRGAAAAPPL
A0A2R9BZA9_BBC3-02      ---------------------------------------ETRGAAAAPPL
A0A2I3RGH5_BBC3-05      ---------------------------------------ETRGAAAAPPL
A0A2K5F6X4_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQPQHRPSPWR
A0A673UKJ9_BBC3-01      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A480SCP6_BBC3-01      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A4X1VVX9_BBC3-01      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A2K5V8L0_BBC3-01      VR-EE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2I3HWI8_BBC3-03      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A671F3X5_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLDALYERR-RQEEQQRHRPSPWR
A0A4W2EKD9_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A4W2EKD9_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A5F5PGZ4_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A2K5QNS7_BBC3-02      VRGEE-----EQWAREIGAQLQRMADDLNAQYERR-RQEEQPQHRPSPWR
A0A2K6STD6_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQPQHRPSPWR
A0A2K6FQZ1_BBC3-04      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
H2NZD3_BBC3-02          VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
Q9BXH1_BBC3-05          VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2R9BZA9_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2I3RGH5_BBC3-03      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2K5P2T8_BBC3-03      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2K6ASP2_BBC3-03      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2I3N2Z9_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2K6QZT2_BBC3-04      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
F7GL32_BBC3-02          HGDQG-----EQQDREIGAQLRRMADDLNALYEQR-RREEEQRRHLSPWR
A0A4X2LVY2_BBC3-01      HGGQA-----EQQDREIGAQLRRMADDLNALYEQR-RREEEQRRHLSPWR
A0A4X2LVY2_BBC3-02      HGGQA-----EQQDREIGAQLRRMADDLNALYEQR-RREEEQRRHLSPWR
A0A2K6KS56_BBC3-01      ---GE-----EA----KWAGNRGPAAADGETTQRAVQTAETRGAAATPPL
A0A2I3RGH5_BBC3-04      SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
A0A2K5F6X4_BBC3-03      SPRGG-----GA----VGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
A0A2K6FQZ1_BBC3-02      SPGGG-----GA----VGPRDRGPAAADGRRPQCAVRAAETRGAAETPPL
A0A671F3X5_BBC3-01      SPGGG-----GA----VGPRDRGPAAANGGRPRRTVRAAETRGAAATPPL
A0A5F5PGZ4_BBC3-01      SPGGG-----GA----VGPGDRGPAAADGGRPERAVRAAETRGAAATPPL
A0A2I3HWI8_BBC3-02      SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGATAAPPL
A0A2K5QNS7_BBC3-01      SPRGG-----GA----VGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
A0A2K5P2T8_BBC3-01      SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
A0A2K6QZT2_BBC3-02      SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
A0A2K6ASP2_BBC3-01      SPRGG-----GT----VGPGDRGPAAADGGRPQRAIRAAETRGAAATPPL
A0A2I3N2Z9_BBC3-01      SPWGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
Q9BXH1_BBC3-03          SPRGG-----GT----VGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPL
A0A2I3RGH5_BBC3-02      SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
H2NZD3_BBC3-01          SPRGG-----GT----VGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
M3Y0R3_BBC3-01          VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
B2RVL4_BBC3-01          VRVEE-----EEWAREIGAQLRRMADDLNAQYERR-RQEEQHRHRPSPWR
Q99ML1_BBC3-02          VRVEE-----EEWAREIGAQLRRMADDLNAQYERR-RQEEQHRHRPSPWR
Q80ZG6_BBC3-01          VRVEE-----EEWAREIGAQLRRMADDLNAQYERR-RQEEQHRHRPSPWR
H0XQ00_BBC3-01          VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A4X1VVX9_BBC3-02      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A4W2EKD9_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A3Q1LXZ6_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A4W2EKD9_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A452E3G1_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A2Y9PEE3_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A337SJI7_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A667IM83_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A480SCP6_BBC3-03      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A2K6FQZ1_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
Q9BXH1_BBC3-06          VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2I3RGH5_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A2K6QZT2_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
A0A0D9S2H2_BBC3-01      VRGEE-----EQWAQEIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
B4DQK3_BBC3-01          VRGEE-----EQWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWR
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          VRV-----------------------------------------------
G3T2N1_BBC3-01          VRGED-----EQWAREIGAQFRRKADDLYALYERSVRQEEQHRHRPSPWR
A0A5F9DGT6_BBC3-01      VWGEE-----EQWAREIVAQLRWMAYDLYAQYE-R-RQEEQQRHRPSPWR
A0A480SCP6_BBC3-02      IRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEEQQRHRPSPWR
A0A7N5KJL4_BBC3-02      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
A0A7N5KJL4_BBC3-01      VRGEE-----EQWAREIGAQLRRMADDLNALYERR-RQEERQRHRPSPWR
                                                                          

F7GL32_BBC3-01          LLY-------NLISGLLAPQRRNRMPDVEPN-------------------
A0A480SCP6_BBC3-04      FPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGAACPRSHRKARAAAGTTG
A0A2K6KS56_BBC3-02      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2K5F6X4_BBC3-01      TLE-------GPVQSHHGTPALSQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A673UKJ9_BBC3-02      TLE-------GPVQSHHGTPALTQGPRSPGDGAQLGACTRPVDVGDLGGR
A0A2K6FQZ1_BBC3-03      TLE-------GPVQSHHGTPALTQGPQSP-DGAQLGACTRLVDVGDLGGR
A0A671F3X5_BBC3-03      ALE-------GPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGGR
A0A2K6STD6_BBC3-01      TLE-------GPVQSHHGTPALSQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2K5P2T8_BBC3-02      ALE-------GPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2K6ASP2_BBC3-02      ALE-------GPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2K6QZT2_BBC3-03      ALE-------GPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2K5QNS7_BBC3-03      ALE-------GPVQSHHGTPALSQGPQSPRDGAQLGACTCPVDVRDSGGR
A0A2I3HWI8_BBC3-01      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
Q9BXH1_BBC3-04          TLE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2R9BZA9_BBC3-02      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2I3RGH5_BBC3-05      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2K5F6X4_BBC3-02      VLY-------NLIMGLLPFPRGHRAPEMEPN-------------------
A0A673UKJ9_BBC3-01      VLY-------NLIMGLLPLPRARGAPEMEPN-------------------
A0A480SCP6_BBC3-01      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A4X1VVX9_BBC3-01      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A2K5V8L0_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2I3HWI8_BBC3-03      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A671F3X5_BBC3-02      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A4W2EKD9_BBC3-01      VLY-------NLIMGLLPFPGGRGAPEVEPN-------------------
A0A4W2EKD9_BBC3-01      VLY-------NLIMGLLPFPGGRGAPEVEPN-------------------
A0A5F5PGZ4_BBC3-02      VLY-------NLIMGLLPLPRGRAAPEMEPN-------------------
A0A2K5QNS7_BBC3-02      VLY-------NLIMGLLPFPRGHRAPEMEPN-------------------
A0A2K6STD6_BBC3-02      VLY-------NLIMGLLPFPRGHRAPEMEPN-------------------
A0A2K6FQZ1_BBC3-04      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
H2NZD3_BBC3-02          VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
Q9BXH1_BBC3-05          VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2R9BZA9_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2I3RGH5_BBC3-03      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2K5P2T8_BBC3-03      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2K6ASP2_BBC3-03      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2I3N2Z9_BBC3-02      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2K6QZT2_BBC3-04      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
F7GL32_BBC3-02          LLY-------NLISGLLAPQRRNRMPDVEPN-------------------
A0A4X2LVY2_BBC3-01      LLY-------NLVSGLLAPHRGNRIPEIEPN-------------------
A0A4X2LVY2_BBC3-02      LLY-------NLVSGLLAPHRGNRIPEIEPN-------------------
A0A2K6KS56_BBC3-01      ALE-------GPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2I3RGH5_BBC3-04      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2K5F6X4_BBC3-03      TLE-------GPVQSHHGTPALSQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2K6FQZ1_BBC3-02      TLE-------GPVQSHHGTPALTQGPQSP-DGAQLGACTRLVDVGDLGGR
A0A671F3X5_BBC3-01      ALE-------GPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGGR
A0A5F5PGZ4_BBC3-01      ALE-------GPVQSHHGTPAPTQGPSGPGDGAQLGACTRPGDVGDLGGR
A0A2I3HWI8_BBC3-02      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2K5QNS7_BBC3-01      ALE-------GPVQSHHGTPALSQGPQSPRDGAQLGACTCPVDVRDSGGR
A0A2K5P2T8_BBC3-01      ALE-------GPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2K6QZT2_BBC3-02      ALE-------GPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2K6ASP2_BBC3-01      ALE-------GPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGR
A0A2I3N2Z9_BBC3-01      ALE-------GPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDLGGR
Q9BXH1_BBC3-03          TLE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
A0A2I3RGH5_BBC3-02      ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
H2NZD3_BBC3-01          ALE-------GPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGR
M3Y0R3_BBC3-01          VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
B2RVL4_BBC3-01          VMY-------NLFMGLLPLPRDPGAPEMEPN-------------------
Q99ML1_BBC3-02          VMY-------NLFMGLLPLPRDPGAPEMEPN-------------------
Q80ZG6_BBC3-01          VMY-------NLFMGLLPLPRDPGAPEMEPN-------------------
H0XQ00_BBC3-01          VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A4X1VVX9_BBC3-02      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A4W2EKD9_BBC3-02      VLY-------NLIMGLLPFPGGRGAPEVEPN-------------------
A0A3Q1LXZ6_BBC3-01      VLY-------NLIMGLLPFPGGRGAPEVEPN-------------------
A0A4W2EKD9_BBC3-02      VLY-------NLIMGLLPFPGGRGAPEVEPN-------------------
A0A452E3G1_BBC3-01      VLY-------NLILGLLPFPGGRGAPEVEPN-------------------
A0A2Y9PEE3_BBC3-01      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A337SJI7_BBC3-01      VLY-------NLIMGLLPLPRARGAPEMEPN-------------------
A0A667IM83_BBC3-01      VLY-------NLITGLLPLPRARGAPEVEPN-------------------
A0A480SCP6_BBC3-03      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A2K6FQZ1_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
Q9BXH1_BBC3-06          VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2I3RGH5_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A2K6QZT2_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
A0A0D9S2H2_BBC3-01      VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
B4DQK3_BBC3-01          VLY-------NLIMGLLPLPRGHRAPEMEPN-------------------
Q99ML1_BBC3-01          --------------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------------
G3T2N1_BBC3-01          VLY-------NLIMGLLPLPRDHGAPEMEPN-------------------
A0A5F9DGT6_BBC3-01      VLY-------NLLMGLLPLPRGPGAPEMEPN-------------------
A0A480SCP6_BBC3-02      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A7N5KJL4_BBC3-02      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
A0A7N5KJL4_BBC3-01      VLY-------NLIMGLLPLPRGRGAPEMEPN-------------------
                                                                          

F7GL32_BBC3-01          --------------------------------------------
A0A480SCP6_BBC3-04      SRARAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYSR
A0A2K6KS56_BBC3-02      --------------------------------------------
A0A2K5F6X4_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A673UKJ9_BBC3-02      TLPPPDALASAGDFFCTM--------------------------
A0A2K6FQZ1_BBC3-03      TLPPPDTLASTGDFFCTM--------------------------
A0A671F3X5_BBC3-03      TLPPPDALASAGDIFCTM--------------------------
A0A2K6STD6_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A2K5P2T8_BBC3-02      PLPPPDTLASAGDFLCTM--------------------------
A0A2K6ASP2_BBC3-02      PLPPPDTLASAGDFLCTM--------------------------
A0A2K6QZT2_BBC3-03      PLPPPDTLASAGDFLCTM--------------------------
A0A2K5QNS7_BBC3-03      PLPPPDTLASAGDFLCTM--------------------------
A0A2I3HWI8_BBC3-01      PLPPPDTLASVGNFLCTM--------------------------
Q9BXH1_BBC3-04          PLPPPDTLASAGDFLCTM--------------------------
A0A2R9BZA9_BBC3-02      PLPPPDTLASAGDFLCTM--------------------------
A0A2I3RGH5_BBC3-05      PLPPPDTLASAGDFLCTM--------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------
A0A2K5V8L0_BBC3-01      --------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------
A0A671F3X5_BBC3-02      --------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------
A0A4W2EKD9_BBC3-01      --------------------------------------------
A0A5F5PGZ4_BBC3-02      --------------------------------------------
A0A2K5QNS7_BBC3-02      --------------------------------------------
A0A2K6STD6_BBC3-02      --------------------------------------------
A0A2K6FQZ1_BBC3-04      --------------------------------------------
H2NZD3_BBC3-02          --------------------------------------------
Q9BXH1_BBC3-05          --------------------------------------------
A0A2R9BZA9_BBC3-01      --------------------------------------------
A0A2I3RGH5_BBC3-03      --------------------------------------------
A0A2K5P2T8_BBC3-03      --------------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------------
A0A2I3N2Z9_BBC3-02      --------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------
F7GL32_BBC3-02          --------------------------------------------
A0A4X2LVY2_BBC3-01      --------------------------------------------
A0A4X2LVY2_BBC3-02      --------------------------------------------
A0A2K6KS56_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A2I3RGH5_BBC3-04      PLPPPDTLASAGDFLCTM--------------------------
A0A2K5F6X4_BBC3-03      PLPPPDTLASAGDFLCTM--------------------------
A0A2K6FQZ1_BBC3-02      TLPPPDTLASTGDFFCTM--------------------------
A0A671F3X5_BBC3-01      TLPPPDALASAGDIFCTM--------------------------
A0A5F5PGZ4_BBC3-01      TLPPPDALASAGGSFCTM--------------------------
A0A2I3HWI8_BBC3-02      PLPPPDTLASVGNFLCTM--------------------------
A0A2K5QNS7_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A2K5P2T8_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A2K6QZT2_BBC3-02      PLPPPDTLASAGDFLCTM--------------------------
A0A2K6ASP2_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
A0A2I3N2Z9_BBC3-01      PLPPPDTLASAGDFLCTM--------------------------
Q9BXH1_BBC3-03          PLPPPDTLASAGDFLCTM--------------------------
A0A2I3RGH5_BBC3-02      PLPPPDTLASAGDFLCTM--------------------------
H2NZD3_BBC3-01          PLPPPDTLASAGDFLCTM--------------------------
M3Y0R3_BBC3-01          --------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------
Q99ML1_BBC3-02          --------------------------------------------
Q80ZG6_BBC3-01          --------------------------------------------
H0XQ00_BBC3-01          --------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------
A0A3Q1LXZ6_BBC3-01      --------------------------------------------
A0A4W2EKD9_BBC3-02      --------------------------------------------
A0A452E3G1_BBC3-01      --------------------------------------------
A0A2Y9PEE3_BBC3-01      --------------------------------------------
A0A337SJI7_BBC3-01      --------------------------------------------
A0A667IM83_BBC3-01      --------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------
A0A2K6FQZ1_BBC3-01      --------------------------------------------
Q9BXH1_BBC3-06          --------------------------------------------
A0A2I3RGH5_BBC3-01      --------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------
A0A0D9S2H2_BBC3-01      --------------------------------------------
B4DQK3_BBC3-01          --------------------------------------------
Q99ML1_BBC3-01          --------------------------------------------
Q99ML1_BBC3-03          --------------------------------------------
G3T2N1_BBC3-01          --------------------------------------------
A0A5F9DGT6_BBC3-01      --------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------
A0A7N5KJL4_BBC3-02      --------------------------------------------
A0A7N5KJL4_BBC3-01      --------------------------------------------
                                                                    

© 1998-2022Legal notice