Dataset for protein classical BH3-containing proteins of organism Vulpes vulpes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------p----------------------------
mtlgrstmrtirpnvtpspvspvrgtawprwtlagrrvarwrrtpsltrfl-gwqsgfspcqrgrgsskspsgsspdrrg
   acksgaragcapplpgpehagaa cahree ag mgcvl mmqipmqgasikgwvrelnipqngpicgffrdcagl 
                                     e al  gglf hae khhedsadaganle              
                                           af   e    ega   a e  g               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
cgrgssrsgssrwlrprcwilgcaagrqvsppcpetpppppspgsgravgaglapwlssgararcggfaelrrffhwrds
a k caedali e                                                                   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
afslhrlrprfqggcsvralldvsggalpcpalpgprlrcrhqqphdpdgerpraagpappvghphslavppggavpsga
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           *    
--------------------------------------------------------------------------mShsgp
cssvselvaedppaagargvdvfavcrahgcartrvpvasgcgwdldvraalgeekggicggrkkdqmakqpsev secd
                                                                  glpnsrgdp pt  
                                                                   ihadle       
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   . :  :   :  *        :        .. * . : .                                     
rsrnlllstflqehgPevrevpgmtdlmeyydpspsPnsnnpddva-------demevrwmlprvgelpgmamyslafty
leggqfqpa---qrp qllpgaptslqttqqrrgsa mgcdkstqtmrlafig---------------------------
 pp   ge gh  gq as khh gagae rs h  f a t e egm       e e lspfrg sssa pnlcaa rygr
                                                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 .    . *.   .           *                   : :..    :         
n--------qtglrgvlrsfldglAnlreni--------riW-----------------srvtfrnrvspnpgrglvlsl
-lrrmsdefpsppcqafnhyssam smmqsqavpadmrpes iaqelrrigdefnayyprflflnsyqaaeahpqmiilr
e         gsfk lp pk a t tq rqs        p                   t  -iwwdr l   -----
                                                                                
                                                                                

       490      
....:....|....:.
                
llllvlllgwglrllq
--ryivr-v-rsq---
  ----- -   aps 
                
                
© 1998-2020Legal notice