Dataset for protein classical BH3-containing proteins of organism Vulpes vulpes

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A3Q7S5V2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A3Q7S5V2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Vulpes vulpes GN=BCL2L11 (length=444 residues).
GRKTGARARCAPPPPPPEHVRAAACPRRTLAAGREAAVRRAGSLPHAGPGWGGGVRACGAPGGGPKCGSGRDCARRGAGK
GSARSALSRELRPRCWILGCAAGRQVSPPCPETPPPPPSPGSGRAVGAGLAPWLSSGARARCGGFAELRRFFHWRDSAFS
LHRLRPRFQGGCSVRALLDVSGGALPCPALPGPRLRCRHQQPHDPDGERPRAAGPAPPVGHPHSLAVPPGGAVPSGACSS
VSELVAEDPPAAGARGVDVFAVCRAHGCARTRVPVASGCGWDLDVRAALGEEKGGICGGRKKDQMAKQPSDVSSECDREG
GQLQPAERPPQLRPGAPTSLQTEQQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRR
IGDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|A0A3Q7SWS0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Vulpes vulpes GN=BAD (length=157 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEEL
SPFRGRSSSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=251 residues).
MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLLRTPSFTRQLAGIKAGFAELQRNQESSISPFFSSPDGLG
CGRGCSEDGSIRWLGLHADLGEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFI
GDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLV
LLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=185 residues).
MGRWRRGMLLTMFLPKHHSWFSDCEIGRNIPNSREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPN
SNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPN
PGRGLVLSLLLLLVLLLGWGLRLLQ
© 1998-2020Legal notice