Dataset for protein classical BH3-containing proteins of organism Vulpes vulpes

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q7S5V2_BCL2L11      ---GRKTGARARCAPPPPPPEHVRAAACPRRTLAAGREAAVRRAGSLPHA
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       -------------------------------------------MFQIPEF
A0A3Q7V097_BIK-03       MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLLRTPSFTRQ
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       -------------------------------------MGRWRRGMLLTMF
                                                                          

A0A3Q7S5V2_BCL2L11      GPGWGGGVRACGAPGGGPKCGSGRDCARRGAGKGSARSALSRELRPRCWI
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       EPSEQEDSSPANRGLG----------------------------------
A0A3Q7V097_BIK-03       LAGIKAGFAELQRNQESSISPFFSSPDGLGCGRGCSEDGSIRWL------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       LPKHHSWFSDCEIGRN----------------------------------
                                                                          

A0A3Q7S5V2_BCL2L11      LGCAAGRQVSPPCPETPPPPPSPGSGRAVGAGLAPWLSSGARARCGGFAE
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
                                                                          

A0A3Q7S5V2_BCL2L11      LRRFFHWRDSAFSLHRLRPRFQGGCSVRALLDVSGGALPCPALPGPRLRC
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
                                                                          

A0A3Q7S5V2_BCL2L11      RHQQPHDPDGERPRAAGPAPPVGHPHSLAVPPGGAVPSGACSSVSELVAE
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
                                                                          

A0A3Q7S5V2_BCL2L11      DPPAAGARGVDVFAVCRAHGCARTRVPVASGCGWDLDVRAALGEEKGGIC
A0A3Q7S5V2_BCL2L11      --------------------------------------------------
A0A3Q7SWS0_BAD-01       --------------------------------------------------
A0A3Q7V097_BIK-03       --------------------------------------------------
A0A3Q7V097_BIK-02       --------------------------------------------------
A0A3Q7V097_BIK-01       --------------------------------------------------
                                                                          

A0A3Q7S5V2_BCL2L11      GGRKKDQMAKQPSDVSSECDREGGQLQPA---ERPPQLRPGAPTSLQTEQ
A0A3Q7S5V2_BCL2L11      -------MAKQPSDVSSECDREGGQLQPA---ERPPQLRPGAPTSLQTEQ
A0A3Q7SWS0_BAD-01       --------------PSPTGDRPPGLLGEAGHQQGQPASRKHHGGAGAETR
A0A3Q7V097_BIK-03       ------GLHADLGEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEY
A0A3Q7V097_BIK-02       --------------MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEY
A0A3Q7V097_BIK-01       -------IPNSREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEY
                                       *       . :  :   :  *        :     

A0A3Q7S5V2_BCL2L11      QDRSPAPMSCDKSTQT----------------------------------
A0A3Q7S5V2_BCL2L11      QDRSPAPMSCDKSTQT----------------------------------
A0A3Q7SWS0_BAD-01       SRHSSFPAGTDEDEGM-------EEEELSPFRGRSSSAPPNLCAALRYGR
A0A3Q7V097_BIK-03       YDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTY
A0A3Q7V097_BIK-02       YDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTY
A0A3Q7V097_BIK-01       YDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTY
                           .. * . : .                                     

A0A3Q7S5V2_BCL2L11      ---------PSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRI
A0A3Q7S5V2_BCL2L11      ---------PSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRI
A0A3Q7SWS0_BAD-01       ELRRMSDEFQGSFKGLPRPKSAGTATQMRQS--------PSW--------
A0A3Q7V097_BIK-03       N--------QTGLRGVLRSFLDGLANLRENI--------RIW--------
A0A3Q7V097_BIK-02       N--------QTGLRGVLRSFLDGLANLRENI--------RIW--------
A0A3Q7V097_BIK-01       N--------QTGLRGVLRSFLDGLANLRENI--------RIW--------
                                         .    . *.   .           *        

A0A3Q7S5V2_BCL2L11      GDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ---
A0A3Q7S5V2_BCL2L11      GDEFNAYYPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ---
A0A3Q7SWS0_BAD-01       ---------TRV-IQSWWDRNLGRG---------------GSAPSQ
A0A3Q7V097_BIK-03       ---------SFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
A0A3Q7V097_BIK-02       ---------SFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
A0A3Q7V097_BIK-01       ---------SFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
                                   : :..    :                         

© 1998-2020Legal notice