Dataset for protein Bik of organism Vulpes vulpes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------r----t--l------f----------------------
mtlacssmrtigpnvtlsgvspaggtawahweeagrrvgrwr-tpsl-rq-pkiksw-selqrnrnssispffsspdglg
                                     macll gmlf mf aghhag adceigqe              

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      **********************************************************
---------------------eMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFI
cgrgcsedgsirwlglpnsrg-                                                          
               ihadle                                                           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
GDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLV
                                                                                
                                                                                

       250 
....:....|.
***********
LLLGWGLRLLQ
           
           
© 1998-2020Legal notice