Dataset for protein Bik of organism Vulpes vulpes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q7V097_BIK-03      MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLLRTPSFTRQ
A0A3Q7V097_BIK-02      --------------------------------------------------
A0A3Q7V097_BIK-01      -------------------------------------MGRWRRGMLLTMF
                                                                         

A0A3Q7V097_BIK-03      LAGIKAGFAELQRNQESSISPFFSSPDGLGCGRGCSEDGSIRWLGLHADL
A0A3Q7V097_BIK-02      --------------------------------------------------
A0A3Q7V097_BIK-01      LPKHHSWFSDCEIGRN-----------------------------IPNSR
                                                                         

A0A3Q7V097_BIK-03      GEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNP
A0A3Q7V097_BIK-02      --MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNP
A0A3Q7V097_BIK-01      EEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNP
                         ************************************************

A0A3Q7V097_BIK-03      DDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSF
A0A3Q7V097_BIK-02      DDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSF
A0A3Q7V097_BIK-01      DDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSF
                       **************************************************

A0A3Q7V097_BIK-03      LDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLL
A0A3Q7V097_BIK-02      LDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLL
A0A3Q7V097_BIK-01      LDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLL
                       **************************************************

A0A3Q7V097_BIK-03      Q
A0A3Q7V097_BIK-02      Q
A0A3Q7V097_BIK-01      Q
                       *

© 1998-2020Legal notice