Dataset for protein Bik of organism Vulpes vulpes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q7V097_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=185 residues).
MGRWRRGMLLTMFLPKHHSWFSDCEIGRNIPNSREEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPN
SNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPN
PGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|A0A3Q7V097_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Vulpes vulpes GN=BIK (length=251 residues).
MTLACSSMRTIGPNVTLSGVSPAGGTAWAHWEEAGRRVACLLRTPSFTRQLAGIKAGFAELQRNQESSISPFFSSPDGLG
CGRGCSEDGSIRWLGLHADLGEMSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLMEYYDPGPSPNSNNPDDVAMRLAFI
GDEMEVRWMLPRVGELPGMAMYSLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLV
LLLGWGLRLLQ
© 1998-2020Legal notice