Dataset for protein Bmf of organism Takifugu rubripes

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGNAGFRLHFPARFEVLGDRGVRR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************:******************************************  *    .  .           
RDTGGAPNGMEPLPQqGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWrlGtallsllfdrgfvagggga
               h                                          ap hrsaqpsv-----------

   
...
   
grr
---
© 1998-2020Legal notice