Dataset for protein Bmf of organism Takifugu rubripes

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3B5KWG6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=163 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGNAGFRLHFPARFEVLGDRGVRR
RDTGGAPNGMEPLPQHGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFDRGFVAGGGGA
GRR
>gnl|bcl2dbpro|A0A3B5KWG6_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=149 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGNAGFRLHFPARFEVLGDRGVRR
RDTGGAPNGMEPLPQQGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWAPGHRSAQPSV
>gnl|bcl2dbpro|A0A3B5KWG6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Takifugu rubripes GN=BMF (length=163 residues).
MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAEEPRLLFYGNAGFRLHFPARFEVLGDRGVRR
RDTGGAPNGMEPLPQQGPVVRSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFDRGFVAGGGGA
GRR
© 1998-2021Legal notice