Dataset for protein Bmf of organism Takifugu rubripes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B5KWG6_BMF-03      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAE
A0A3B5KWG6_BMF-02      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAE
A0A3B5KWG6_BMF-01      MDDEEDDVFQPDPYSWRTTFQEIKCEDRGTQTPGPTLAPHSGMLPCGVAE
                       **************************************************

A0A3B5KWG6_BMF-03      EPRLLFYGNAGFRLHFPARFEVLGDRGVRRRDTGGAPNGMEPLPQQGPVV
A0A3B5KWG6_BMF-02      EPRLLFYGNAGFRLHFPARFEVLGDRGVRRRDTGGAPNGMEPLPQHGPVV
A0A3B5KWG6_BMF-01      EPRLLFYGNAGFRLHFPARFEVLGDRGVRRRDTGGAPNGMEPLPQQGPVV
                       *********************************************:****

A0A3B5KWG6_BMF-03      RSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWAPGHRSAQPSV-
A0A3B5KWG6_BMF-02      RSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFD
A0A3B5KWG6_BMF-01      RSTEACIGQKLQLIGDQFHRERVQLYQRNQRNQGPLWWRLGTALLSLLFD
                       **************************************  *    .  . 

A0A3B5KWG6_BMF-03      -------------
A0A3B5KWG6_BMF-02      RGFVAGGGGAGRR
A0A3B5KWG6_BMF-01      RGFVAGGGGAGRR
                                    

© 1998-2020Legal notice