Dataset for protein Bmf of organism Taeniopygia guttata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
                                                                                
                                                                                

       170       180       190       200
....:....|....:....|....:....|....:....|
  ..  :   .:*    . .                    
--qnrnqvwwqlFlflhnlalntevnrnhtgqr-------
vqrteikcggsf ssyttwp-------------nhwlclk
hg                                      
© 1998-2020Legal notice