Dataset for protein Bmf of organism Taeniopygia guttata

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674GIP8_BMF-03      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
A0A674GIP8_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
A0A674GIP8_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
                       **************************************************

A0A674GIP8_BMF-03      LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A674GIP8_BMF-01      LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A674GIP8_BMF-02      LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A674GIP8_BMF-03      RRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A674GIP8_BMF-01      RRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIA
A0A674GIP8_BMF-02      RRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIA
                       **************************************************

A0A674GIP8_BMF-03      DQFHRLHIQRVGRTEIKCGGSFFSSYTTWP--------------------
A0A674GIP8_BMF-01      DQFHRLHIQRHQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQRNHWLCLK
A0A674GIP8_BMF-02      DQFHRLHIQR--QNRNQVWWQLFLFLHNLALNTEVNRNHTGQR-------
                       **********  ..  :   .:*    . .                    

© 1998-2020Legal notice