Dataset for protein Bmf of organism Taeniopygia guttata

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A674GIP8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=200 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNTEVNRNHTGQRNHWLCLK
>gnl|bcl2dbpro|A0A674GIP8_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=180 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
VGRTEIKCGGSFFSSYTTWP
>gnl|bcl2dbpro|A0A674GIP8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Taeniopygia guttata GN=BMF (length=191 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQR
QNRNQVWWQLFLFLHNLALNTEVNRNHTGQR
© 1998-2021Legal notice