Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
etpdiepglsgllrlsaggsggvpvpwftlyserplcstrtprppplslgwvelvgeeerlhclprvlmpgfksgvpcfe
            mtvfv  ca q    vsppmrpsqsvlsrshllleha lecv rsspgap                vp
                               tmsgg lggpi g            aq                      
                                 g a                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------arreggspep-eg-rr-r----------parvs-cs--e-gl-ap
lgdgcalshpqspctsqstpvsrsltsapshsskreeqgqsgr--v--t--g-prpypssrlv-sa--g-glc-p--p-a
q g  pggrmdagacpmlivpnqpvsqtrgsamah--l-----raqralagdqsglfllemfqi--fead-gaqaqsss-
          a     igg elpnsl ghtqqtrksg-rddvfqeeg ep tg   asq     rs   qpfv ss dcd
                      cg a   cggi    aap tgp pa vg s            te   a eq d     
                                       a f   g  r  n            p               
                                         a                                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ra-gptlf---paahccap--lpaa--------wpg------------------------------r-------------
--lardplgtdgrgylvigtg----tlslggpr-a-glrrfhfaprslqvsslqerlvprsrprrr-hhgyrhhhrlltv
ps --qaa   -ltga-gsrapgtvsaakatqtl-ph                     qqrqragpspdr          
lg rle--    -s--tf-ssr lsredp hlgfsa                        g   ssqi            
   ts- v    q-wr - gl    qfc     ec                              h              
   c s t     pf  s                                                              
     c                                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------pqpslapalqs--spvpsapqrl------------ag----lalgirgeeeq-----w-a---g
alrvlfsaasiasdcwvr-apsayehhlefrwtessgasfyakfrllfaemt-gptqatpqlqparkkappil-a-rei-
                tagrqgvmtp-apcg-rgl-sc- agnagyrlplp- rrsrrpt-tnnt-va     l qprpe
                as -a-c--- qga-y--et--d            p tedg-n-pe--psg-       phda 
                --  -e-rsr   -s   - ee             e f aee-s -  - -s        q y 
                g   v t           g                       l  f  r l             
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .                                                                      
vqlarqpddvsslyer----------------------------------------------------------------
aemrkmasrlndecdkrvseggqlqpawdfprgggwerppqlrpgaptslqterqgnpegegdrcpqgspqgplapptsp
d-i iklrcigaqfhf   a  gvdgr         g  s mc  sccparrg a drqvg aa  rs            
- c   fqefag---                                                                 
r     s   q sln                                                                 
            k k                                                                 
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------qq-rsppwqvllnllsglaslrrsrgepadmr-----
gpfatrsplfifvrrssllsrsssgyfsfdtdrspapmscdqs-rt----crafyhyimamlpmgqgqaa-----peiwi
                               rlqeeqlhmtkht-hqpsv----nlf-hn-frhpt----gemppnnah 
                               h prrksagqttsmnpnrsrwqi---pakwwlrndenrnr gesra   
                               g kaparrqreq  r agaaskvtvc --a yg sp el  psq     
                                     anfeag  a     ks  r  rs  g      g  ele     
                                                          qp            a       

       490       500       510       520       530
....:....|....:....|....:....|....:....|....:....|
                                                  
--------------------------------------------------
aqelrrigdefnayyprrvmlfslppfsphtlpppyillryiarlvwrmq
s ai           s  lfqnnyqaaea pqmvilr             
                   e                              
                                                  
                                                  
                                                  
© 1998-2020Legal notice