Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
etpdiepgssglltlsaggsggvpvpwftpyserplcstrtprppplhlglvclvgeeerlhclprvlmpgfksgvpcfe
mgipenmslasthrqgirkpsas   pgsllemggrgrsgsgpls        v  aspg p                vp
           gmkvwvsrclpe   tvrgetgssgwnrlpsyva                                   
            k mrsa  a q   rie pplpatalpivrsr                                    
               fl          e   l a a el q lq                                    
                                     ce   ha                                    
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
lgdgcalshpqapctsqltvplcpvlqapshsskharrgqggrraqrgtrrgrprlylserlvparvsgcsgaeaglssp
q g  pggr d                  gsamar  qegsspepve la dg  pfpls    sa    glc p  paa
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
ragrdlagaghavigrglgaaslslggprwaaglrrfhfaprslqvsslqerlvprrrrrrrrhhryrhhhrlltvalrv
p apt lp aylcaptapp vtaa      pg                        s p gp pdg              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------makqpsdvssecdr---egg
lfsaasiasdcwvrpapaaathsapfpwpsspqcltggptqltlglrnarkkwareigqq---------erseqrvsdvs
            pq slsp eqhles v  a ga a     aap i geeeq      dslfqitpqevaqlrd   -df
                                                          rnhsmeagscf-----   g--
                                                          aa rrm dgrmglasa   aaa
                                                             qgl   ln  v      el
                                                               a   ac  y        
                                                                       t        
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qlqpa---------erppqlrpgaptslqterqg-p-s---rcp-g-p--p-----------------------------
sp---wdfprgggw------arvglgpfpqgql-p-e-sgd---p-h-qg-gapptspgpfatrsplfpavrrssggsrs
--eeg         ppgtgpcdrsadqsvlsdspcslgepwltaqtslgaallrtylqedklcqtqgqifssshhllp w
racgv         gv raf--dw-r ehfptrdngpvrlqpfelflcce r acl  aay  hqlap   taal     
gvsfc            arv sp-ch iar  pvlcfckclalrrsc t  a           aptta            
 gd r            s m g-q c arg  gsdra qsg s     a                               
                   a anc        d  av g s                                       
                      m         a   q a a                                       
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------apmscdkstqtpsgpcqafnhylsamas---------mR---------------qsqaep
sggyfsfdtdrspdgpqpsls-a-rsr-sp---p--e--g-lfqe-pgpvpsapgali-lplpagfpsglplgrsps---
as pr rprgpra       -v-t---g--yse-vtalp-t----lsp         fg        arrntqe-lpepq
p        h k        qseeqhqhvsvrcatg-eeqrptyga--         y               tn--rga
                    raqgprlegml rsfesdargedepne          r               pget vr
                    g raatvr ls d aapkvtlcpah            -                tqe lg
                        gpt  rr a  q slsvaer             l                r r   
                              a         p                g                  a   
                                                         a                      

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               :                                                                
admrpeiw---iaqelrrigDefnayyprr----------------------------------------fq-ht--pwr
--waaqvyare-gaqfqcma-dlh-lf---arvglyprvssqwavpfesqglsgsevqarlpvmlfslep-sr-qqp---
iqh--sqqgqlc---i---s q-qr-heqk                             psqrpksagpaq-pr-psqpy
wl-eeare   tsrk kal- k -gstrkg                               alfqnrytemeqprlnsnl
lppdr sh     ir      -  qr kws                                kartnqqctamkpsmvik
 rgs  aa      a            sv                                  qnrppklarlg ywgqm
 al                        m                                   e liaf l a  ea  h
                                                               s    a k s       
                                                               l      g         

       570       580      
....:....|....:....|....:.
                          
--------l--l--------------
vlynllmg-lp-prgrgapemepnpr
iwwriilswhrralhgdenrngag  
rilqfvafiwnwnsrmqglapsq   
caaay qy ay vw  rn        
    q rk fw gt            
      gr va mq            
       a    l             
                          
© 1998-2020Legal notice