Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtpdiepglsgllrlsaggsggvvvpwftlyserplcstrtprppplhlglvclvgeeerlhclprvlmpgfksgvpcfe
eespqcv srirmtvmvs wepqsrsvvrpptqntssalgpshl         v  aspg p                vp
 r sgsl     gl fsa ccelpg qssnlqmlgggr                                          
               e   aa i    pmgipgg a l                                          
                             ah  a                                              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------hrrrgssp-rpeegtrrgrprp-p-s------------svs-csla
lgdgcalshpqapctsqltvplcpvlqapshsskealedqggreavrdlagdq--ly-s-rlvfqipefepa---g----
q g  pggr d                 sgstrr-eqsqgvfvssqfarp tgst-fllepfm       qsrqvdsggc
                            mtraqgamaqedfstqepc es nc  svsadqs         qeals pps
                            caqmmar kkapedpt aa vg c   rg              pa e     
                                a i  a aa gp    ge                              
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
e-gl----a--dl-paghlcap---------tglpa------------g-----------------------r-r--srp
-p--sspp-grt-lg-aycvigghlgeaghqrapg-vslslggprwag-lrrfhfaprslqvsslqerlvpr-r-rrrqh
ra  paartap-af-l--a---         ----tataah     paa                    prsspphgpye
dr  gps   lq a rtw-tgs         glr ls sh                              et s  sls-
          te   qsgr f          ssq                                           f s
                p              q                                             a  
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .                                             
dg--------------------------prpslspatpsapsplp-----------------------sspgclaggptq
hryrhhhrlltvalrvlfsaasiasdcwvqqapaateqhlef-w-sqgcrvtglssrsfyakfrllfa-a-qa-t-----
-k                          at-tfctgahrqgvyvq   ag reepq l agnagyrlpe-e--rsrrnsg
s-                          --e-er esetsacm-                       lqmarrp-mlrll
el                          tpar g  d e --                          lt  qaf  q  
ae                          rl q        sp                           p  f       
                             e d                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :    .       .                                               
aapgirnarkr-eveiadqlrriaddlnalyer-----------------------------------------------
ltlplvgeeeqw-r---akmakmpsqfssecdqrvseggqlqpawdfprgggwerppqlrpgaptslqterqgnpegegd
tq trgqwqpkpa-qcgr-fqcqg evhr-hmk   a  gvdgr         g  s mc  sccparrg a drqvg a
en aemalphdagiw  ie    s ----yfr                                                
se  dlw----y     -       k qksnp                                                
      r aq       q          g  k                                                
                               f                                                
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------rrq--q-------r-----wq-l--llsamls
rcpqgspqgplapptspgpfatrsplfifvrrssllsrsssgyfsfdtq--pa-mscdkst-trspp--a-nhyilhnap
a  rs                                           dhsqnpsagtttqqvppsscrvfynvfmglwa
                                                klpeeka   agnmhwagaakivtvnprsw y
                                                h krra      s rq    ss  rfmqps k
                                                g  ap         a      l   c nlk g
                                                                           ifi f
                                                                             a  

       490       500       510       520       530       540       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
lrrsrgepadmp-------------------------------------------------------
mpqgqa---a-rreiwiaqelrrigdefnayyprrvmlnsyqpfsphtqpvpyrllryiarlvwrmq
rhgpetrng-g-paah s ai           s  lfqfnlpaaea plmpili             
pfsd-nlrepesn                       e                              
gn th-a pmyq                                                       
 l lgeg   si                                                       
          l                                                        
                                                                   
© 1998-2020Legal notice