Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A287AEF3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=209 residues).
MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQPWRT
APGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSD
EFQGSFKKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
>gnl|bcl2dbpro|A0A287AIU8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=168 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWWQILLFLHNLALHGDE
NRNGAGPR
>gnl|bcl2dbpro|A0A287AIU8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sus scrofa GN=BMF (length=183 residues).
MEPPQCVEELEDDVFQPEEGEPGTQPRRVSADPFVQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQG
VMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVWW
QILLFLHNLALHGDENRNGAGPR
>gnl|bcl2dbpro|C1KGB6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=404 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSS
LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
RLEQ
>gnl|bcl2dbpro|C1KGB6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=433 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSS
LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
RVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|C1KGB6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=364 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAD
MRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|C1KGB8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVM
LFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|F1RM01_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=361 residues).
MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDA
PCTSQLTVPLCPVLQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
LRRMADDLNALYERRVSAGGGVDGRWDFPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGAACPRSHRKARAAAGTTGSRA
RAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYSR
>gnl|bcl2dbpro|F1RM01_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=216 residues).
MASGACPISGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAA
YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREI
GAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|F1RM01_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|F1SMU1_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=121 residues).
ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPT
RVALPPDPEVECAIQFRRIGDKLNFRQKLLNLIAKLFRLGT
>gnl|bcl2dbpro|Q9GL49_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Sus scrofa GN=PMAIP1 (length=176 residues).
MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGRCGQTRREELRGSFGPPPAAVRGNQPTSEAFGRSGCCFSSSLP
LARFCPTAPRAACYLQSQGARVRGLSSRSFAAKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLNF
RQKLLNLIAKLFRLGT
© 1998-2020Legal notice