Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

30 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A480SCP6_BBC3-04      ------------MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLG
A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       ------MGSSGGKKLWLARPSPS---------------------------
A0A287AEF3_BAD-01       MGIPENPSSASTHTQGIRKSGAE---------------------------
A0A4X1VE31_BAD-03       MGIPENPSSASTHTQGIRKSGAE---------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      LVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDAPCTSQLTV
A0A287AEC6_BCL2L11      ---LVGEEERLH----------------FELGDGCALSHPQ---------
A0A287AEC6_BCL2L11      ---LVGEEERLH----------------FELGDGCALSHPQ---------
A0A287AEC6_BCL2L11      ---LVGEEERLH----------------FELGDGCALSHPQ---------
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      PLCPVLQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVS-C
A0A287AEC6_BCL2L11      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE---PARVSGC
A0A287AEC6_BCL2L11      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE---PARVSGC
A0A287AEC6_BCL2L11      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE---PARVSGC
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       ----------------------------------MCPCPL----------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------MASGACPISGPVSRNLSQAPGSAMAR----------
A0A4X1VE31_BAD-02       -----------------------------MFQIP--EFEQ----------
A0A4X1VE31_BAD-01       --------TEEPLPLPSTGNRGPSLRAQSMFQIP--EFEQ----------
A0A287AEF3_BAD-01       --------PGTPEEGGGRGRSRSGPASQSMFQIP--EFEQ----------
A0A4X1VE31_BAD-03       --------PGTPEEGGGRGRSRQGYLSQSMFQIP--EFEQ----------
Q9GL49_PMAIP1-01        -------------------MRSSGSLGSRIRGLLESAGWE----------
A0A480SCP6_BBC3-03      -------------------------------------MAR----------
A0A4X1VVX9_BBC3-02      -------------------------------------MAR----------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      GLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG-------
A0A287AEC6_BCL2L11      SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLS-----WAAGLRRFHFA
A0A287AEC6_BCL2L11      SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLS-----WAAGLRRFHFA
A0A287AEC6_BCL2L11      SGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLS-----WAAGLRRFHFA
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      --------------PRSRPRGPRPDG------------------------
A0A287AEC6_BCL2L11      PRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASD
A0A287AEC6_BCL2L11      PRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASD
A0A287AEC6_BCL2L11      PRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASD
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A4X1VE31_BAD-02       --------------------------------------------------
A0A4X1VE31_BAD-01       --------------------------------------------------
A0A287AEF3_BAD-01       --------------------------------------------------
A0A4X1VE31_BAD-03       --------------------------------------------------
Q9GL49_PMAIP1-01        --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      --PQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
A0A287AEC6_BCL2L11      CWVRPAPAAATHSAPFPWPSSPQCLT-----LTLGLRNARKK------DQ
A0A287AEC6_BCL2L11      CWVRPAPAAATHSAPFPWPSSPQCLT-----LTLGLRNARKK------DQ
A0A287AEC6_BCL2L11      CWVRPAPAAATHSAPFPWPSSPQCLT-----LTLGLRNARKK------DQ
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       ------------------------------------------------HR
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      ------------------------------------------------AR
A0A4X1VE31_BAD-02       ------------------------------------------------SE
A0A4X1VE31_BAD-01       ------------------------------------------------SE
A0A287AEF3_BAD-01       ------------------------------------------------SE
A0A4X1VE31_BAD-03       ------------------------------------------------SE
Q9GL49_PMAIP1-01        ------------------------------------------------EL
A0A480SCP6_BBC3-03      ------------------------------------------------AR
A0A4X1VVX9_BBC3-02      ------------------------------------------------AR
A0A287AIU8_BMF-02       --------------------------------------------------
A0A287AIU8_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-01       --------------------------------------------------
A0A4X1UQ42_BMF-02       --------------------------------------------------
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      LRRMADDLNALYERRVSAGGGVDG-------------RWDFPRGGGWGRP
A0A287AEC6_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A287AEC6_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A287AEC6_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1TQ35_PMAIP1-      --------------------------------------------------
F1SMU1_PMAIP1-01        --------------------------------------------------
A0A4X1TMB1_HRK-01       GRGPPAVCACSASR---LGLRSSA--------------------------
A0A480SCP6_BBC3-01      -----ARVSAGAAR---ACPCPVPRAFCSPWPHQI---------------
A0A4X1VVX9_BBC3-01      -----ARVSAGAAR---ACPCPVPRAFCSPWPHQI---------------
A0A480SCP6_BBC3-02      QEGSSPEPVEGLAR---DGPRPFPLSRLVPSAVSCGLC---------EPG
A0A4X1VE31_BAD-02       QEDSSP------AD---RGLGPSPTGDRPPGPSKPWRT---------APG
A0A4X1VE31_BAD-01       QEDSSP------AD---RGLGPSPTGDRPPGPSKPWRT---------APG
A0A287AEF3_BAD-01       QEDSSP------AD---RGLGPSPTGTDP----QPWRT---------APG
A0A4X1VE31_BAD-03       QEDSSP------AD---RGLGPSPTGDRPPGPSKPWRT---------APG
Q9GL49_PMAIP1-01        VRSQPRAHQGLTSG---RCGQTRR------EELRGSFG---------PPP
A0A480SCP6_BBC3-03      QEGSSPEPVEGLAR---DGPRPFPLSRLVPSAVSCGLC---------EPG
A0A4X1VVX9_BBC3-02      QEGSSPEPVEGLAR---DGPRPFPLSRLVPSAVSCGLC---------EPG
A0A287AIU8_BMF-02       --MEPPQCVEELED---DVFQPEE-------------G---------EPG
A0A287AIU8_BMF-01       --MEPPQCVEELED---DVFQPEE-------------G---------EPG
A0A4X1UQ42_BMF-01       --MEPPQCVEELED---DVFQPEE-------------G---------EPG
A0A4X1UQ42_BMF-02       --MEPPQCVEELED---DVFQPEE-------------G---------EPG
A0A287AEC6_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1VMQ3_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
C1KGB8_BCL2L11-01       MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1VMQ3_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1VMQ3_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1VMQ3_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
C1KGB6_BCL2L11-01       MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
A0A4X1VMQ3_BCL2L11      MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
C1KGB7_BCL2L11-01       MAKQPSDVSSECDR---EGGQLQP-------------A---------ERP
                                                                          

A0A480SCP6_BBC3-04      SQMC-GSCCPARRGRA----GDRQVGGAACPRS-----------------
A0A287AEC6_BCL2L11      PQLRPGAPTSLQTERQ----------------------------------
A0A287AEC6_BCL2L11      PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
A0A287AEC6_BCL2L11      PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
A0A4X1TQ35_PMAIP1-      --------TSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGL
F1SMU1_PMAIP1-01        ARAAAGAPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGL
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      LPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPR-GPRP--
A0A4X1VE31_BAD-02       HLGEAG-----------HQQGQPASSSHHGG---AGAVETRSRHSSYP--
A0A4X1VE31_BAD-01       HLGEAG-----------HQQGQPASSSHHGG---AGAVETRSRHSSYP--
A0A287AEF3_BAD-01       HLGEAG-----------HQQGQPASSSHHGG---AGAVETRSRHSSYP--
A0A4X1VE31_BAD-03       HLGEAG-----------HQQGQPASSSHHGG---AGAVETRSRHSSYP--
Q9GL49_PMAIP1-01        AAVRGNQPTSEAFGRSGCCFSSSLPLARFCPTAPRAACYLQSQGARVRGL
A0A480SCP6_BBC3-03      LPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRP---
A0A4X1VVX9_BBC3-02      LPAAPAAPTLLPAAYLCA--TAPAVTAALGGPRWPGGPRSRPRGPRP---
A0A287AIU8_BMF-02       TQPRRVSADPFVQSQL----DCPLSRLQLFPLTHCCGPGLRPTSQE----
A0A287AIU8_BMF-01       TQPRRVSADPFVQSQL----DCPLSRLQLFPLTHCCGPGLRPTSQE----
A0A4X1UQ42_BMF-01       TQPRRVSADPFVQSQL----DCPLSRLQLFPLTHCCGPGLRPTSQE----
A0A4X1UQ42_BMF-02       TQPRRVSADPFVQSQL----DCPLSRLQLFPLTHCCGPGLRPTSQE----
A0A287AEC6_BCL2L11      PQLRPGAPTSLQTERQ----------------------------------
A0A4X1VMQ3_BCL2L11      PQLRPGAPTSLQTERQ----------------------------------
C1KGB8_BCL2L11-01       PQLRPGAPTSLQTERQ----------------------------------
A0A4X1VMQ3_BCL2L11      PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
A0A4X1VMQ3_BCL2L11      PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
A0A4X1VMQ3_BCL2L11      PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
C1KGB6_BCL2L11-01       PQLRPGAPTSLQTERQ----GNPEGEGDRCPQGSPQGPLAPPTSPGPFAT
A0A4X1VMQ3_BCL2L11      PQLRPGAPTSLQTERQ----------------------------------
C1KGB7_BCL2L11-01       PQLRPGAPTSLQTERQ----------------------------------
                                                                          

A0A480SCP6_BBC3-04      --------------------------HRKARAAAGTTGSRARAGAASSVT
A0A287AEC6_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
A0A287AEC6_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A287AEC6_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A4X1TQ35_PMAIP1-      SSRSFAAKFRLLFAEMP---------GRRSRRNTQTNPTRVALPPDPEVE
F1SMU1_PMAIP1-01        SSRSFAAKFRLLFAEMP---------GRRSRRNTQTNPTRVALPPDPEVE
A0A4X1TMB1_HRK-01       --------------------------------------------------
A0A480SCP6_BBC3-01      --------------------------HGPQPSLSPAEQHLESPVPS----
A0A4X1VVX9_BBC3-01      --------------------------HGPQPSLSPAEQHLESPVPS----
A0A480SCP6_BBC3-02      --------------------------DGPQPSLSPAEQHLESPVPS----
A0A4X1VE31_BAD-02       --------------------------EGTEEDEGTEDEELSP--------
A0A4X1VE31_BAD-01       --------------------------EGTEEDEGTEDEELSP--------
A0A287AEF3_BAD-01       --------------------------EGTEEDEGTEDEELSP--------
A0A4X1VE31_BAD-03       --------------------------EGTEEDEGTEDEELSP--------
Q9GL49_PMAIP1-01        SSRSFAAKFRLLFAEMP---------GRRSRRNTQTNPTRVALPP-----
A0A480SCP6_BBC3-03      --------------------------DGPQPSLSPAEQHLESPVPS----
A0A4X1VVX9_BBC3-02      --------------------------DGPQPSLSPAEQHLESPVPS----
A0A287AIU8_BMF-02       --------------------------DKATQTLSPASPSQGVMLPCGVTE
A0A287AIU8_BMF-01       --------------------------DKATQTLSPASPSQGVMLPCGVTE
A0A4X1UQ42_BMF-01       --------------------------DKATQTLSPASPSQGVMLPCGVTE
A0A4X1UQ42_BMF-02       --------------------------DKATQTLSPASPSQGVMLPCGVTE
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A4X1VMQ3_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A4X1VMQ3_BCL2L11      RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
C1KGB6_BCL2L11-01       RSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A4X1VMQ3_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
C1KGB7_BCL2L11-01       --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
                                                                          

A0A480SCP6_BBC3-04      V------------------CPRPAAGGRRPRELRAALSRAAH---ISQAI
A0A287AEC6_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A287AEC6_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A287AEC6_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A4X1TQ35_PMAIP1-      ---------------------------------------------CAIQF
F1SMU1_PMAIP1-01        ---------------------------------------------CAIQF
A0A4X1TMB1_HRK-01       ------------------------------------------AQLTAARL
A0A480SCP6_BBC3-01      -------------------APGALAGGPTQAAPGIRGEEEQWAREIGAQL
A0A4X1VVX9_BBC3-01      -------------------APGALAGGPTQAAPGIRGEEEQWAREIGAQL
A0A480SCP6_BBC3-02      -------------------APGALAGGPTQAAPGIRGEEEQWAREIGAQL
A0A4X1VE31_BAD-02       ------------------------FRGRSLSAPPILWAAQRYGRE----L
A0A4X1VE31_BAD-01       ------------------------FRGRSLSAPPILWAAQRYGRE----L
A0A287AEF3_BAD-01       ------------------------FRGRSLSAPPILWAAQRYGRE----L
A0A4X1VE31_BAD-03       ------------------------FRGRSLSAPPILWAAQRYGRE----L
Q9GL49_PMAIP1-01        -------------------------------------DPEVE---CAIQF
A0A480SCP6_BBC3-03      -------------------APGALAGGPTQAAPGIRGEEEQWAREIGAQL
A0A4X1VVX9_BBC3-02      -------------------APGALAGGPTQAAPGIRGEEEQWAREIGAQL
A0A287AIU8_BMF-02       EPQRLFY---------------GLPLGEQPPEGQWQHRAEVQ---IARKL
A0A287AIU8_BMF-01       EPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQ---IARKL
A0A4X1UQ42_BMF-01       EPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQ---IARKL
A0A4X1UQ42_BMF-02       EPQRLFYGNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQ---IARKL
A0A287AEC6_BCL2L11      ------------------------ASMRQSQAEPADMRPEIW---IAQEL
A0A4X1VMQ3_BCL2L11      ------------------------ASMRQSQAEPADMRPEIW---IAQEL
C1KGB8_BCL2L11-01       ------------------------ASMRQSQAEPADMRPEIW---IAQEL
A0A4X1VMQ3_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A4X1VMQ3_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A4X1VMQ3_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
C1KGB6_BCL2L11-01       H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
A0A4X1VMQ3_BCL2L11      H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
C1KGB7_BCL2L11-01       H------------------YLSAMASMRQSQAEPADMRPEIW---IAQEL
                                                                         :

A0A480SCP6_BBC3-04      -----------------------YSR------------------------
A0A287AEC6_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A287AEC6_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A287AEC6_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A4X1TQ35_PMAIP1-      RRIGDKLN---------------FRQK-----------------------
F1SMU1_PMAIP1-01        RRIGDKLN---------------FRQK-----------------------
A0A4X1TMB1_HRK-01       KALGDELH-----------QRTMWRRS-----------------------
A0A480SCP6_BBC3-01      RRMADDLN-------------ALYERR-----------------------
A0A4X1VVX9_BBC3-01      RRMADDLN-------------ALYERR-----------------------
A0A480SCP6_BBC3-02      RRMADDLN-------------ALYERR-----------------------
A0A4X1VE31_BAD-02       RRMSDEFQ-------------GSFKKG-----------------------
A0A4X1VE31_BAD-01       RRMSDEFQ-------------GSFKVSARVGLYPRVSSQWAVPFESQGLS
A0A287AEF3_BAD-01       RRMSDEFQ-------------GSFKKG-----------------------
A0A4X1VE31_BAD-03       RRMSDEFQ-------------GSF-KG-----------------------
Q9GL49_PMAIP1-01        RRIGDKLN---------------FRQK-----------------------
A0A480SCP6_BBC3-03      RRMADDLN-------------ALYERR-----------------------
A0A4X1VVX9_BBC3-02      RRMADDLN-------------ALYERR-----------------------
A0A287AIU8_BMF-02       QCIADQFHRLHMQQHQQNQNRVWWQIL-----------------------
A0A287AIU8_BMF-01       QCIADQFHRLHMQQHQQNQNRVWWQIL-----------------------
A0A4X1UQ42_BMF-01       QCIADQFHRLHMQQHQQNQNRVWWQIL-----------------------
A0A4X1UQ42_BMF-02       QCIADQFHRLHMQQHQQNQNRVWWQIL-----------------------
A0A287AEC6_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A4X1VMQ3_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
C1KGB8_BCL2L11-01       RRIGDEFN-------------AYYPRR-----------------------
A0A4X1VMQ3_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A4X1VMQ3_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
A0A4X1VMQ3_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
C1KGB6_BCL2L11-01       RRIGDEFN-------------AYYPRR-----------------------
A0A4X1VMQ3_BCL2L11      RRIGDEFN-------------AYYPRR-----------------------
C1KGB7_BCL2L11-01       RRIGDEFN-------------AYYPRR-----------------------
                                               :                          

A0A480SCP6_BBC3-04      --------------------------------------------------
A0A287AEC6_BCL2L11      -------------------------------VMLFSLPPFSPHTLPPPYI
A0A287AEC6_BCL2L11      -------------------------------VFLNNYQAAEAHPQMVILR
A0A287AEC6_BCL2L11      -------------------------------LEQ----------------
A0A4X1TQ35_PMAIP1-      -------------------------------LLNLIAKLFRLGT------
F1SMU1_PMAIP1-01        -------------------------------LLNLIAKLFRLGT------
A0A4X1TMB1_HRK-01       --------ARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL----
A0A480SCP6_BBC3-01      -------------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEP
A0A4X1VVX9_BBC3-01      -------------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEP
A0A480SCP6_BBC3-02      -------------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEP
A0A4X1VE31_BAD-02       -------LPRPKSAGTATQMRQSPSWK---RFLQSWWYRNSGRGGPAPSQ
A0A4X1VE31_BAD-01       GSEVQAPLQKAKTPGFPKSLKREAGWH-----LGS---------------
A0A287AEF3_BAD-01       -------LPRPKSAGTATQMRQSPSWK---RFLQSWWYRNSGRGGPAPSQ
A0A4X1VE31_BAD-03       -------LPRPKSAGTATQMRQSPSWK---RFLQSWWYRNSGRGGPAPSQ
Q9GL49_PMAIP1-01        -------------------------------LLNLIAKLFRLGT------
A0A480SCP6_BBC3-03      -------------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEP
A0A4X1VVX9_BBC3-02      -------------RQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEP
A0A287AIU8_BMF-02       -------------------------------LFLHNLALHGDENRNGAGP
A0A287AIU8_BMF-01       -------------------------------LFLHNLALHGDENRNGAGP
A0A4X1UQ42_BMF-01       -------------------------------LFLHNLALHGDENRNGAGP
A0A4X1UQ42_BMF-02       -------------------------------LFLHNLALHGDENRNGAGP
A0A287AEC6_BCL2L11      -------------------------------LA----ECLASHT------
A0A4X1VMQ3_BCL2L11      -------------------------------LA----ECLASHT------
C1KGB8_BCL2L11-01       -------------------------------VMLFSLPPFSPHTLPPPYI
A0A4X1VMQ3_BCL2L11      -------------------------------VFLNNYQAAEAHPQMVILR
A0A4X1VMQ3_BCL2L11      -------------------------------LEQ----------------
A0A4X1VMQ3_BCL2L11      -------------------------------VMLFSLPPFSPHTLPPPYI
C1KGB6_BCL2L11-01       -------------------------------VMLFSLPPFSPHTLPPPYI
A0A4X1VMQ3_BCL2L11      -------------------------------VFLNNYQAAEAH---PQMV
C1KGB7_BCL2L11-01       -------------------------------VMLFSLPPFSPHTLPPPYI
                                                                          

A0A480SCP6_BBC3-04      ----------------
A0A287AEC6_BCL2L11      ----------------
A0A287AEC6_BCL2L11      LLRYIARLVWRMQ---
A0A287AEC6_BCL2L11      ----------------
A0A4X1TQ35_PMAIP1-      ----------------
F1SMU1_PMAIP1-01        ----------------
A0A4X1TMB1_HRK-01       ----------------
A0A480SCP6_BBC3-01      N---------------
A0A4X1VVX9_BBC3-01      N---------------
A0A480SCP6_BBC3-02      N---------------
A0A4X1VE31_BAD-02       ----------------
A0A4X1VE31_BAD-01       ----------------
A0A287AEF3_BAD-01       ----------------
A0A4X1VE31_BAD-03       ----------------
Q9GL49_PMAIP1-01        ----------------
A0A480SCP6_BBC3-03      N---------------
A0A4X1VVX9_BBC3-02      N---------------
A0A287AIU8_BMF-02       R---------------
A0A287AIU8_BMF-01       R---------------
A0A4X1UQ42_BMF-01       R---------------
A0A4X1UQ42_BMF-02       R---------------
A0A287AEC6_BCL2L11      ----------------
A0A4X1VMQ3_BCL2L11      ----------------
C1KGB8_BCL2L11-01       ----------------
A0A4X1VMQ3_BCL2L11      ---LLRYIARLVWRMQ
A0A4X1VMQ3_BCL2L11      ----------------
A0A4X1VMQ3_BCL2L11      ----------------
C1KGB6_BCL2L11-01       ----------------
A0A4X1VMQ3_BCL2L11      ILRLLRYIARLVWRMQ
C1KGB7_BCL2L11-01       ----------------
                                        

© 1998-2022Legal notice