Dataset for protein classical BH3-containing proteins of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1RM01_BBC3-04         ------------MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLG
C1KGB6_BCL2L11-02      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
C1KGB6_BCL2L11-03      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
C1KGB6_BCL2L11-01      ETPDIEPGLSGLLRLSAGGSGGV---WFTLYSERPLCSTRTPRPP-----
A0A287AEF3_BAD-01      ----------------------------MGIPENPSSA------------
F1RM01_BBC3-02         ---------------MASGACPISGPVSRNLSQAPGSA------------
F1RM01_BBC3-03         --------------------------------------------------
Q9GL49_PMAIP1-01       MRSSGSLGSRIRGLLESAGWEELVRSQPRAHQGLTSGR------------
A0A287AIU8_BMF-02      MEPPQCV-------------------------------------------
A0A287AIU8_BMF-01      MEPPQCV-------------------------------------------
C1KGB8_BCL2L11-01      --------------------------------------------------
F1SMU1_PMAIP1-01       --------------------------------------------------
                                                                         

F1RM01_BBC3-04         LVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDAPCTSQLTV
C1KGB6_BCL2L11-02      ---LVGEEERLH----------------FELGDGCALSHPQ---------
C1KGB6_BCL2L11-03      ---LVGEEERLH----------------FELGDGCALSHPQ---------
C1KGB6_BCL2L11-01      ---LVGEEERLH----------------FELGDGCALSHPQ---------
A0A287AEF3_BAD-01      --------------------------------------------------
F1RM01_BBC3-02         --------------------------------------------------
F1RM01_BBC3-03         --------------------------------------------------
Q9GL49_PMAIP1-01       --------------------------------------------------
A0A287AIU8_BMF-02      --------------------------------------------------
A0A287AIU8_BMF-01      --------------------------------------------------
C1KGB8_BCL2L11-01      --------------------------------------------------
F1SMU1_PMAIP1-01       --------------------------------------------------
                                                                         

F1RM01_BBC3-04         PLCPVLQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLV-------
C1KGB6_BCL2L11-02      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE----------
C1KGB6_BCL2L11-03      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE----------
C1KGB6_BCL2L11-01      --------PSHSSKHARRGQGGRRAQRGTRRGRPRLYLSE----------
A0A287AEF3_BAD-01      --------STHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPEFE
F1RM01_BBC3-02         --------MARA---RQEGSSP-EPVEGLARDGPRPFPLSRLV-------
F1RM01_BBC3-03         -----------MARARQEGSSP-EPVEGLARDGPRPFPLSRLV-------
Q9GL49_PMAIP1-01       --------CGQTRREELRGSFG-PPPAAVRGNQPTS--------------
A0A287AIU8_BMF-02      --------------EELEDDVF-QPEEGEPGTQPRRVSADPFV-------
A0A287AIU8_BMF-01      --------------EELEDDVF-QPEEGEPGTQPRRVSADPFV-------
C1KGB8_BCL2L11-01      ---------------MAKQPSDVSSECDREGGQ-----------------
F1SMU1_PMAIP1-01       --------------ARAAAGAPTSEAFGRSGCC-----------------
                                                                         

F1RM01_BBC3-04         PSAVS-CGLCEPGLPAAPAAPTLLPAAYLCAP---------TAPPAVTAA
C1KGB6_BCL2L11-02      PARVSGCSGAEAGLSSPRAGRDLAGAGHAVIG---------RGLGAASLS
C1KGB6_BCL2L11-03      PARVSGCSGAEAGLSSPRAGRDLAGAGHAVIG---------RGLGAASLS
C1KGB6_BCL2L11-01      PARVSGCSGAEAGLSSPRAGRDLAGAGHAVIG---------RGLGAASLS
A0A287AEF3_BAD-01      QSEQEDSSPADRGLGPSPTGTD--PQPWRTAPGHLGEAGHQQGQPASSSH
F1RM01_BBC3-02         -PSAVSCGLCEPGLPAAPAAPTLLPAAYLCAP---------TAPPAVTAA
F1RM01_BBC3-03         -PSAVSCGLCEPGLPAAPAAPTLLPAAYLCAP---------TAPPAVTAA
Q9GL49_PMAIP1-01       ---------------------EAFGRSGCCFS---------SSLPL----
A0A287AIU8_BMF-02      -QSQLDCPLSR---------LQLFPLTHCCGP---------GLRPT----
A0A287AIU8_BMF-01      -QSQLDCPLSR---------LQLFPLTHCCGP---------GLRPT----
C1KGB8_BCL2L11-01      --------------------------------------------------
F1SMU1_PMAIP1-01       --------------------------------------------------
                                                                         

F1RM01_BBC3-04         LGGPRWPGG---------------------PRSRPRGPRPDG--------
C1KGB6_BCL2L11-02      -----WAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLL
C1KGB6_BCL2L11-03      -----WAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLL
C1KGB6_BCL2L11-01      -----WAAGLRRFHFAPRSLQVSSLQERLVPRRRRRRRRHHRYRHHHRLL
A0A287AEF3_BAD-01      HGG---AGA--------------------VETRSRHSSYPEG--------
F1RM01_BBC3-02         LGGPRWPGG--------------------PRSRPR-GPRPDG--------
F1RM01_BBC3-03         LGGPRWPGG--------------------PRSRPR-GPRPDG--------
Q9GL49_PMAIP1-01       -------------------------------------AR-----------
A0A287AIU8_BMF-02      -------------------------------------SQEDK--------
A0A287AIU8_BMF-01      -------------------------------------SQEDK--------
C1KGB8_BCL2L11-01      -------------------------------------LQPAE--------
F1SMU1_PMAIP1-01       -------------------------------------FSSSL--------
                                                                         

F1RM01_BBC3-04         ------------------PQPSLSPAEQHLESPVP---------------
C1KGB6_BCL2L11-02      TVALRVLFSAASIASDCWVRPAPAAATHSAPFPWP---------------
C1KGB6_BCL2L11-03      TVALRVLFSAASIASDCWVRPAPAAATHSAPFPWP---------------
C1KGB6_BCL2L11-01      TVALRVLFSAASIASDCWVRPAPAAATHSAPFPWP---------------
A0A287AEF3_BAD-01      ------------------TEEDEGTEDEELSP------------------
F1RM01_BBC3-02         ------------------PQPSLSPAEQHLESPVP---------------
F1RM01_BBC3-03         ------------------PQPSLSPAEQHLESPVP---------------
Q9GL49_PMAIP1-01       ----------------------FCPTAPRAACYLQSQGARVRGLSSRSFA
A0A287AIU8_BMF-02      ------------------ATQTLSPASPSQGVMLP---CGVTEEPQRLFY
A0A287AIU8_BMF-01      ------------------ATQTLSPASPSQGVMLP---CGVTEEPQRLFY
C1KGB8_BCL2L11-01      ------------------RPPQLRPGAPTS--------------------
F1SMU1_PMAIP1-01       ------------------PLARFCPTAPRAACYLQSQGARVRGLSSRSFA
                                               .                         

F1RM01_BBC3-04         --------SAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
C1KGB6_BCL2L11-02      --------SSPQCLT-----LTLGLRNARKK------DQMAKQPSDVSSE
C1KGB6_BCL2L11-03      --------SSPQCLT-----LTLGLRNARKK------DQMAKQPSDVSSE
C1KGB6_BCL2L11-01      --------SSPQCLT-----LTLGLRNARKK------DQMAKQPSDVSSE
A0A287AEF3_BAD-01      --------------FRGRSLSAPPILWAAQRYGRE----LRRMSDEFQGS
F1RM01_BBC3-02         --------SAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
F1RM01_BBC3-03         --------SAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNAL
Q9GL49_PMAIP1-01       AKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGD---KL
A0A287AIU8_BMF-02      ---------------GLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRL
A0A287AIU8_BMF-01      GNAGYRLPLPAGFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRL
C1KGB8_BCL2L11-01      -------LQTERQASMRQSQAEPADMR----PEIWIAQELRRIGDEFNAY
F1SMU1_PMAIP1-01       AKFRLLFAEMPGRRSRRNTQTNPTRVALPPDPEVECAIQFRRIGDKLN--
                                                              :    .     

F1RM01_BBC3-04         YERRVSAGGGVDGRWDFPRGGGWGRPSQMC-GSCCPARRGRAGDRQVGGA
C1KGB6_BCL2L11-02      CDR---EGGQLQPA---------ERPPQLRPGAPTSLQTERQ--------
C1KGB6_BCL2L11-03      CDR---EGGQLQPA---------ERPPQLRPGAPTSLQTERQGNPEGEGD
C1KGB6_BCL2L11-01      CDR---EGGQLQPA---------ERPPQLRPGAPTSLQTERQGNPEGEGD
A0A287AEF3_BAD-01      FKK-----------------------------------------------
F1RM01_BBC3-02         YER-----------------------------------------------
F1RM01_BBC3-03         YER-----------------------------------------------
Q9GL49_PMAIP1-01       NFR-----------------------------------------------
A0A287AIU8_BMF-02      HMQ-----------------------------------------------
A0A287AIU8_BMF-01      HMQ-----------------------------------------------
C1KGB8_BCL2L11-01      YPR-----------------------------------------------
F1SMU1_PMAIP1-01       FRQ-----------------------------------------------
                         .                                               

F1RM01_BBC3-04         ACPRS-------------------------------------------HR
C1KGB6_BCL2L11-02      ------------------------------------------------DR
C1KGB6_BCL2L11-03      RCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDR
C1KGB6_BCL2L11-01      RCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDR
A0A287AEF3_BAD-01      ------------------------------------------------GL
F1RM01_BBC3-02         ------------------------------------------------RR
F1RM01_BBC3-03         ------------------------------------------------RR
Q9GL49_PMAIP1-01       ------------------------------------------------Q-
A0A287AIU8_BMF-02      ------------------------------------------------QH
A0A287AIU8_BMF-01      ------------------------------------------------QH
C1KGB8_BCL2L11-01      ------------------------------------------------R-
F1SMU1_PMAIP1-01       ------------------------------------------------K-
                                                                         

F1RM01_BBC3-04         KARAAAGTTGSRARAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQA
C1KGB6_BCL2L11-02      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQE
C1KGB6_BCL2L11-03      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQE
C1KGB6_BCL2L11-01      SPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQE
A0A287AEF3_BAD-01      PRPKSAGTATQMRQSPSWK---RFLQSWWYRNSGRGGPAPSQ--------
F1RM01_BBC3-02         QEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-------
F1RM01_BBC3-03         QEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-------
Q9GL49_PMAIP1-01       ------------------KLL--NLIAKLFRLGT----------------
A0A287AIU8_BMF-02      QQNQ------NRVW---WQIL--LFLHNLALHGDENRNGAGPR-------
A0A287AIU8_BMF-01      QQNQ------NRVW---WQIL--LFLHNLALHGDENRNGAGPR-------
C1KGB8_BCL2L11-01      -----------------------VMLFSLPPFSPHTLPPPYI--------
F1SMU1_PMAIP1-01       -----------------------LLNLIAKLFRLGT--------------
                                                                         

F1RM01_BBC3-04         I----------YSR---------------------------------
C1KGB6_BCL2L11-02      LRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI-------------
C1KGB6_BCL2L11-03      LRRIGDEFNAYYPRRLEQ-----------------------------
C1KGB6_BCL2L11-01      LRRIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
A0A287AEF3_BAD-01      -----------------------------------------------
F1RM01_BBC3-02         -----------------------------------------------
F1RM01_BBC3-03         -----------------------------------------------
Q9GL49_PMAIP1-01       -----------------------------------------------
A0A287AIU8_BMF-02      -----------------------------------------------
A0A287AIU8_BMF-01      -----------------------------------------------
C1KGB8_BCL2L11-01      -----------------------------------------------
F1SMU1_PMAIP1-01       -----------------------------------------------
                                                                      

© 1998-2020Legal notice