Dataset for protein Bim of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
etpdiepglsgllrlsaggsggvwftlyserplcstrtprpplvgeeerlhfelgdgcalshpqpshsskharrgqggrr
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aqrgtrrgrprlylseparvsgcsgaeaglsspragrdlagaghavigrglgaaslswaaglrrfhfaprslqvsslqer
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                             ***
-----------------------------------------------------------------------------MAK
lvprrrrrrrrhhryrhhhrlltvalrvlfsaasiasdcwvrpapaaathsapfpwpsspqcltltlglrnarkkdq   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************                                          
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ------------------------------------------
                                      gnpegegdrcpqgspqgplapptspgpfatrsplfifvrrss
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            ************************************
--------------drspapmscdkstqtpsppcqafnhylsamASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
llsrsssgyfsfdt------------------------------                                    
                                                                                
                                                                                

       410       420       430      
....:....|....:....|....:....|....:.
*:                                  
Rvmlfslppfspht--ppyi----------------
 lf----qaaea--lp----ilrllryiarlvwrmq
  eqnny----- pqmvilr                
  a    eclas     qmv                
© 1998-2022Legal notice