Dataset for protein Bim of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A287AEC6_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
ECLASHT
>gnl|bcl2dbpro|A0A287AEC6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=364 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAD
MRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|A0A287AEC6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=433 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSS
LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
RVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|A0A287AEC6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=404 residues).
ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERLHFELGDGCALSHPQPSHSSKHARRGQGGRR
AQRGTRRGRPRLYLSEPARVSGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPRSLQVSSLQER
LVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCWVRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAK
QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVRRSS
LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
RLEQ
>gnl|bcl2dbpro|A0A4X1VMQ3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A4X1VMQ3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=87 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRLA
ECLASHT
>gnl|bcl2dbpro|A0A4X1VMQ3_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=183 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|A0A4X1VMQ3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|A0A4X1VMQ3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
>gnl|bcl2dbpro|C1KGB6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=183 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPPTSPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAY
YPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|C1KGB7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=127 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PADMRPEIWIAQELRRIGDEFNAYYPRRVMLFSLPPFSPHTLPPPYI
>gnl|bcl2dbpro|C1KGB8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sus scrofa GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPRRVM
LFSLPPFSPHTLPPPYI
© 1998-2022Legal notice