Dataset for protein Bim of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


C1KGB8_BCL2L11-01      --------------------------------------------------
C1KGB6_BCL2L11-02      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-03      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
C1KGB6_BCL2L11-01      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
                                                                         

C1KGB8_BCL2L11-01      --------------------------------------------------
C1KGB6_BCL2L11-02      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-03      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
C1KGB6_BCL2L11-01      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
                                                                         

C1KGB8_BCL2L11-01      --------------------------------------------------
C1KGB6_BCL2L11-02      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
C1KGB6_BCL2L11-03      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
C1KGB6_BCL2L11-01      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
                                                                         

C1KGB8_BCL2L11-01      --------------------------------------------------
C1KGB6_BCL2L11-02      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
C1KGB6_BCL2L11-03      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
C1KGB6_BCL2L11-01      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
                                                                         

C1KGB8_BCL2L11-01      -------------------------------------MAKQPSDVSSECD
C1KGB6_BCL2L11-02      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
C1KGB6_BCL2L11-03      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
C1KGB6_BCL2L11-01      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
                                                            *************

C1KGB8_BCL2L11-01      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
C1KGB6_BCL2L11-02      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
C1KGB6_BCL2L11-03      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
C1KGB6_BCL2L11-01      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
                       ****************************                      

C1KGB8_BCL2L11-01      --------------------------------------------------
C1KGB6_BCL2L11-02      ----------------------------------DRSPAPMSCDKSTQTP
C1KGB6_BCL2L11-03      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
C1KGB6_BCL2L11-01      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
                                                                         

C1KGB8_BCL2L11-01      --------------ASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB6_BCL2L11-02      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB6_BCL2L11-03      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB6_BCL2L11-01      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
                                     ************************************

C1KGB8_BCL2L11-01      RVMLFSLPPFSPHTLPPPYI-------------
C1KGB6_BCL2L11-02      RVMLFSLPPFSPHTLPPPYI-------------
C1KGB6_BCL2L11-03      RLEQ-----------------------------
C1KGB6_BCL2L11-01      RVFLNNYQAAEAHPQMVILRLLRYIARLVWRMQ
                       *:                               

© 1998-2020Legal notice