Dataset for protein Bim of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
A0A287AEC6_BCL2L11      ETPDIEPGLSGLLRLSAGGSGGVWFTLYSERPLCSTRTPRPPLVGEEERL
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AEC6_BCL2L11      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
A0A287AEC6_BCL2L11      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
A0A287AEC6_BCL2L11      HFELGDGCALSHPQPSHSSKHARRGQGGRRAQRGTRRGRPRLYLSEPARV
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AEC6_BCL2L11      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
A0A287AEC6_BCL2L11      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
A0A287AEC6_BCL2L11      SGCSGAEAGLSSPRAGRDLAGAGHAVIGRGLGAASLSWAAGLRRFHFAPR
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AEC6_BCL2L11      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
A0A287AEC6_BCL2L11      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
A0A287AEC6_BCL2L11      SLQVSSLQERLVPRRRRRRRRHHRYRHHHRLLTVALRVLFSAASIASDCW
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB6_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB7_BCL2L11-01       --------------------------------------------------
                                                                          

A0A287AEC6_BCL2L11      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
A0A287AEC6_BCL2L11      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
A0A287AEC6_BCL2L11      VRPAPAAATHSAPFPWPSSPQCLTLTLGLRNARKKDQMAKQPSDVSSECD
A0A287AEC6_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A4X1VMQ3_BCL2L11      -------------------------------------MAKQPSDVSSECD
C1KGB8_BCL2L11-01       -------------------------------------MAKQPSDVSSECD
A0A4X1VMQ3_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A4X1VMQ3_BCL2L11      -------------------------------------MAKQPSDVSSECD
A0A4X1VMQ3_BCL2L11      -------------------------------------MAKQPSDVSSECD
C1KGB6_BCL2L11-01       -------------------------------------MAKQPSDVSSECD
A0A4X1VMQ3_BCL2L11      -------------------------------------MAKQPSDVSSECD
C1KGB7_BCL2L11-01       -------------------------------------MAKQPSDVSSECD
                                                             *************

A0A287AEC6_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
A0A287AEC6_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
A0A287AEC6_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
A0A287AEC6_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
A0A4X1VMQ3_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
C1KGB8_BCL2L11-01       REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
A0A4X1VMQ3_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
A0A4X1VMQ3_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
A0A4X1VMQ3_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
C1KGB6_BCL2L11-01       REGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPLAPP
A0A4X1VMQ3_BCL2L11      REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
C1KGB7_BCL2L11-01       REGGQLQPAERPPQLRPGAPTSLQTERQ----------------------
                        ****************************                      

A0A287AEC6_BCL2L11      ----------------------------------DRSPAPMSCDKSTQTP
A0A287AEC6_BCL2L11      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
A0A287AEC6_BCL2L11      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
A0A287AEC6_BCL2L11      --------------------------------------------------
A0A4X1VMQ3_BCL2L11      --------------------------------------------------
C1KGB8_BCL2L11-01       --------------------------------------------------
A0A4X1VMQ3_BCL2L11      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
A0A4X1VMQ3_BCL2L11      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
A0A4X1VMQ3_BCL2L11      TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
C1KGB6_BCL2L11-01       TSPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTP
A0A4X1VMQ3_BCL2L11      ----------------------------------DRSPAPMSCDKSTQTP
C1KGB7_BCL2L11-01       ----------------------------------DRSPAPMSCDKSTQTP
                                                                          

A0A287AEC6_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A287AEC6_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A287AEC6_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A287AEC6_BCL2L11      --------------ASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A4X1VMQ3_BCL2L11      --------------ASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB8_BCL2L11-01       --------------ASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A4X1VMQ3_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A4X1VMQ3_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A4X1VMQ3_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB6_BCL2L11-01       SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
A0A4X1VMQ3_BCL2L11      SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
C1KGB7_BCL2L11-01       SPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQELRRIGDEFNAYYPR
                                      ************************************

A0A287AEC6_BCL2L11      RVMLFSLPPFSPHTLPPPYI----------------
A0A287AEC6_BCL2L11      RVFLNNYQAAEAHPQMVILR---LLRYIARLVWRMQ
A0A287AEC6_BCL2L11      RLEQ--------------------------------
A0A287AEC6_BCL2L11      RLA----ECLASHT----------------------
A0A4X1VMQ3_BCL2L11      RLA----ECLASHT----------------------
C1KGB8_BCL2L11-01       RVMLFSLPPFSPHTLPPPYI----------------
A0A4X1VMQ3_BCL2L11      RVFLNNYQAAEAHPQMVILR---LLRYIARLVWRMQ
A0A4X1VMQ3_BCL2L11      RLEQ--------------------------------
A0A4X1VMQ3_BCL2L11      RVMLFSLPPFSPHTLPPPYI----------------
C1KGB6_BCL2L11-01       RVMLFSLPPFSPHTLPPPYI----------------
A0A4X1VMQ3_BCL2L11      RVFLNNYQAAEAH---PQMVILRLLRYIARLVWRMQ
C1KGB7_BCL2L11-01       RVMLFSLPPFSPHTLPPPYI----------------
                        *:                                  

© 1998-2022Legal notice