Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mtvfvggcagqpvpwvspptmggacllgpshlpplhlglvcvvgaspglpclprvlmpgfksgvpcvpqgggcpggrpds
                                                                             maa

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    : **.*       ** *.*  :* *: *
--------------------mararqegsspepveglardgprpfplsrlvpsaVScGlcepglpAApAaPtllPaAylC
pctsqstvvsrpvsqapgsa--------------------------------ar  a -------  r c cpv r f- 
gacpilgpplcnll                                                                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:               **          .  *************************************************
ap-appavtaalggprWPggprsrprgprpdGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
s-t-------------  ---------hqih                                                 
   ta                                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************** .         :  * . *    ::  .  *  ***..     .                     
LRRMADDLNALYERRrqeeq------qrhRpspWrvlynlimgllPlpRGRgapemepn---------------------
               vsagggvdgrwdfp ggg grpsqmcgscc ar   agdrqvggaacprshrkaraaagttgsra
                                                                                

       330       340       350       360 
....:....|....:....|....:....|....:....|.
                                         
-----------------------------------------
ragaassvtvcprpaaggrrprelraalsraahisqaiysr
                                         
© 1998-2021Legal notice