Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------g-cp---p--
mtvfvggcagqpvpwvspptmggacllgpshlpplhlglvcvvgaspglpclprvlmpgfksgvpcvpqs-g--isr-vs
                                                                   mag a  ggg da

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    ************************************************************
---s----------qapgsaMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLC
rnt-qltvplcpvl------                                                            
pcl                                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*************** .         :  * . *    ::  .  *  ***..     .                     
LRRMADDLNALYERRrqeeq------qrhRpspWrvlynlimgllPlpRGRgapemepn---------------------
               vsagggvdgrwdfp ggg grpsqmcgscc ar   agdrqvggaacprshrkaraaagttgsra
                                                                                

       330       340       350       360 
....:....|....:....|....:....|....:....|.
                                         
-----------------------------------------
ragaassvtvcprpaaggrrprelraalsraahisqaiysr
                                         
© 1998-2020Legal notice