Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A480SCP6_BBC3-04      MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLP
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      CLPRVLMPGFKSGVPCVPQGGGCPGGRPDAPCTSQLTVPLCPVLQAPGSA
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      ---------------------------MASGACPISGPVSRNLSQAPGSA
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A480SCP6_BBC3-01      ----------ARVSAGAARACPCPVPRA----------FCSP--------
A0A4X1VVX9_BBC3-01      ----------ARVSAGAARACPCPVPRA----------FCSP--------
A0A480SCP6_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A480SCP6_BBC3-03      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A4X1VVX9_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
                                  .    * **  * *.* :          :*.*        

A0A480SCP6_BBC3-04      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
A0A480SCP6_BBC3-01      --------------------------WP---------HQIHGPQPSLSPA
A0A4X1VVX9_BBC3-01      --------------------------WP---------HQIHGPQPSLSPA
A0A480SCP6_BBC3-02      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
A0A480SCP6_BBC3-03      PTLLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
A0A4X1VVX9_BBC3-02      PTLLPAAYLCA--TAPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPA
                                                  **          .  *********

A0A480SCP6_BBC3-04      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
A0A480SCP6_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
A0A4X1VVX9_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
A0A480SCP6_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
A0A480SCP6_BBC3-03      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
A0A4X1VVX9_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A480SCP6_BBC3-04      LYERRVSAGGGVDGRWDFPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGA
A0A480SCP6_BBC3-01      LYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A4X1VVX9_BBC3-01      LYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A480SCP6_BBC3-02      LYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A480SCP6_BBC3-03      LYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
A0A4X1VVX9_BBC3-02      LYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
                        ***** .         :  * . *    ::  .  *  ***..     . 

A0A480SCP6_BBC3-04      ACPRSHRKARAAAGTTGSRARAGAASSVTVCPRPAAGGRRPRELRAALSR
A0A480SCP6_BBC3-01      --------------------------------------------------
A0A4X1VVX9_BBC3-01      --------------------------------------------------
A0A480SCP6_BBC3-02      --------------------------------------------------
A0A480SCP6_BBC3-03      --------------------------------------------------
A0A4X1VVX9_BBC3-02      --------------------------------------------------
                                                                          

A0A480SCP6_BBC3-04      AAHISQAIYSR
A0A480SCP6_BBC3-01      -----------
A0A4X1VVX9_BBC3-01      -----------
A0A480SCP6_BBC3-02      -----------
A0A480SCP6_BBC3-03      -----------
A0A4X1VVX9_BBC3-02      -----------
                                   

© 1998-2022Legal notice