Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F1RM01_BBC3-04      MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLPCLPRVLMPGF
F1RM01_BBC3-02      ------------------------------------------------------------
F1RM01_BBC3-03      ------------------------------------------------------------
                                                                                

F1RM01_BBC3-04      KSGVPCVPQGGGCPGGRPDAPCTSQLTVPLCPVLQAPGSAMARARQEGSSPEPVEGLARD
F1RM01_BBC3-02      -------MASGACPISGPVSRNLS----------QAPGSAMARARQEGSSPEPVEGLARD
F1RM01_BBC3-03      ----------------------------------------MARARQEGSSPEPVEGLARD
                                                            ********************

F1RM01_BBC3-04      GPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
F1RM01_BBC3-02      GPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
F1RM01_BBC3-03      GPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
                    ************************************************************

F1RM01_BBC3-04      PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
F1RM01_BBC3-02      PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
F1RM01_BBC3-03      PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
                    ************************************************************

F1RM01_BBC3-04      LRRMADDLNALYERRVSAGGGVDGRWDFPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGA
F1RM01_BBC3-02      LRRMADDLNALYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
F1RM01_BBC3-03      LRRMADDLNALYERRRQEEQ------QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN-
                    *************** .         :  * . *    ::  .  *  ***..     . 

F1RM01_BBC3-04      ACPRSHRKARAAAGTTGSRARAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYS
F1RM01_BBC3-02      ------------------------------------------------------------
F1RM01_BBC3-03      ------------------------------------------------------------
                                                                                

F1RM01_BBC3-04      R
F1RM01_BBC3-02      -
F1RM01_BBC3-03      -
                     

© 1998-2020Legal notice