Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A480SCP6_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=216 residues).
MASGACPISGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAA
YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREI
GAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A480SCP6_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=361 residues).
MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDA
PCTSQLTVPLCPVLQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
LRRMADDLNALYERRVSAGGGVDGRWDFPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGAACPRSHRKARAAAGTTGSRA
RAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYSR
>gnl|bcl2dbpro|A0A480SCP6_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A480SCP6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=130 residues).
ARVSAGAARACPCPVPRAFCSPWPHQIHGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A4X1VVX9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=130 residues).
ARVSAGAARACPCPVPRAFCSPWPHQIHGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A4X1VVX9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=191 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCATAPAVTAALGGPRWPGGPR
SRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
HRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2022Legal notice