Dataset for protein Puma of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|F1RM01_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=361 residues).
MTVFVGGCAGQPVPWVSPPTMGGACLLGPSHLPPLHLGLVCVVGASPGLPCLPRVLMPGFKSGVPCVPQGGGCPGGRPDA
PCTSQLTVPLCPVLQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQ
LRRMADDLNALYERRVSAGGGVDGRWDFPRGGGWGRPSQMCGSCCPARRGRAGDRQVGGAACPRSHRKARAAAGTTGSRA
RAGAASSVTVCPRPAAGGRRPRELRAALSRAAHISQAIYSR
>gnl|bcl2dbpro|F1RM01_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=216 residues).
MASGACPISGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAA
YLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREI
GAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|F1RM01_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Sus scrofa GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPTLLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
© 1998-2020Legal notice