Dataset for protein Bad of organism Sus scrofa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            ****************************  *    :
------pssasthtqgirksgaepgtpeegggrgrsr-g--sqsMFQIPEFEQSEQEDSSPADRGLGPSPTGdrPpgpsk
mgipen-------------------------------s-yr---                            td ----q
      mg sggkklwlarpspstee lplpst nrgqspla                                      
                                     p la                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
PWRTAPGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELR
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********  .                              * ..*:.* ...:.....*:  * *            
RMSDEFQGSFkkg------------------------------LprpKsaGtatqmrqspsWkrfLqSwwyrnsgrggpa
          -vsarvglyprvssqwavpfesqglsgsevqap qka tp fpkslkreag h-- g ------------
                                                                                
                                                                                

   
...
   
psq
---
   
   
© 1998-2020Legal notice