Dataset for protein Bad of organism Sus scrofa

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A287AEF3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=209 residues).
MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPEFEQSEQEDSSPADRGLGPSPTGTDPQPWRT
APGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSD
EFQGSFKKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
>gnl|bcl2dbpro|A0A4X1VE31_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=212 residues).
MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRQGYLSQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSK
PWRTAPGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELR
RMSDEFQGSFKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
>gnl|bcl2dbpro|A0A4X1VE31_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=169 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKPWRTAPGHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
EEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEFQGSFKKGLPRPKSAGTATQMRQSPSWKRFLQSWWYRNS
GRGGPAPSQ
>gnl|bcl2dbpro|A0A4X1VE31_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sus scrofa GN=BAD (length=220 residues).
MGSSGGKKLWLARPSPSTEEPLPLPSTGNRGPSLRAQSMFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKPWRTAP
GHLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILWAAQRYGRELRRMSDEF
QGSFKVSARVGLYPRVSSQWAVPFESQGLSGSEVQAPLQKAKTPGFPKSLKREAGWHLGS
© 1998-2022Legal notice