Dataset for protein Bad of organism Sus scrofa

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4X1VE31_BAD-02      --------------------------------------------MFQIPE
A0A4X1VE31_BAD-01      ------MGSSGGKKLWLARPSPSTEEPLPLPSTGNRGPSLRAQSMFQIPE
A0A287AEF3_BAD-01      MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRSGPASQSMFQIPE
A0A4X1VE31_BAD-03      MGIPENPSSASTHTQGIRKSGAEPGTPEEGGGRGRSRQGYLSQSMFQIPE
                                                                   ******

A0A4X1VE31_BAD-02      FEQSEQEDSSPADRGLGPSPTGDRPPGPSKPWRTAPGHLGEAGHQQGQPA
A0A4X1VE31_BAD-01      FEQSEQEDSSPADRGLGPSPTGDRPPGPSKPWRTAPGHLGEAGHQQGQPA
A0A287AEF3_BAD-01      FEQSEQEDSSPADRGLGPSPTGTDP----QPWRTAPGHLGEAGHQQGQPA
A0A4X1VE31_BAD-03      FEQSEQEDSSPADRGLGPSPTGDRPPGPSKPWRTAPGHLGEAGHQQGQPA
                       **********************  *    :********************

A0A4X1VE31_BAD-02      SSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILW
A0A4X1VE31_BAD-01      SSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILW
A0A287AEF3_BAD-01      SSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILW
A0A4X1VE31_BAD-03      SSSHHGGAGAVETRSRHSSYPEGTEEDEGTEDEELSPFRGRSLSAPPILW
                       **************************************************

A0A4X1VE31_BAD-02      AAQRYGRELRRMSDEFQGSFKKG---------------------------
A0A4X1VE31_BAD-01      AAQRYGRELRRMSDEFQGSFKVSARVGLYPRVSSQWAVPFESQGLSGSEV
A0A287AEF3_BAD-01      AAQRYGRELRRMSDEFQGSFKKG---------------------------
A0A4X1VE31_BAD-03      AAQRYGRELRRMSDEFQGSF-KG---------------------------
                       ********************  .                           

A0A4X1VE31_BAD-02      ---LPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
A0A4X1VE31_BAD-01      QAPLQKAKTPGFPKSLKREAGWH--LGS---------------
A0A287AEF3_BAD-01      ---LPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
A0A4X1VE31_BAD-03      ---LPRPKSAGTATQMRQSPSWKRFLQSWWYRNSGRGGPAPSQ
                          * ..*:.* ...:.....*:  * *               

© 1998-2020Legal notice