Dataset for protein classical BH3-containing proteins of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------makqpsdvssecdreggqlqpaerppqlrpgaptslqt
cfqgkvrtfvtvpgsrpardlglmyssagaaracpwkvgasl---v-rqicgptstasppsptlrasv-------alagg
                       hspl  rg daremgqiqevpr-te-nyetrpslratpssvfs--psahht -----
                                    afphp fepse-rmrfkqnhkltlvrhtdl tfaqeag svtsv
                                            gm qpdp gngaga aeldg g a  ha   eg dr
                                             c  ea   ma      a                 k
                                                     k                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qrq--pg------p-----g-------------------------------------------a----------------
p--tn--legdrc-qpspq-plappaspgpfatrsplfifvrrssllsrsssgyfsfdtdrsp-pmscdkstqtpsppcq
htvgalegyyeagtwgvevssssvhmrsrwvldemrvrwtrp vlsppvtqqyswaqtyssyslrtvlrsqmdgllssre
-qsqpdvirlgppssqrssarqdregglaftga  ehitm   rge ggmal rl  pgnqtg nlfeqelleeee ll 
 prpga eq  eeqranqp  d  ac a aie    g                       ll  ggea  g  c a h  
 gpad  al     f idn                                                             
        f       g i                                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------asmrqsqaapadm---------------------------------------------------------r
ainhylsamp-lgrt-----alqtlspaspsqgvmlpcgvteepqrlfygnagyrlplpasfpaglplgeqppeghwqh-
nfrvwsflt-r----ssplr--                                                         y
l plthccglqr vmrqegpnt                                                         e
         dln p ppddng                                                          c
          gg   ln  k                                                           a
          f    ad  d                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
peiwiaqelrrigdefnayy---pr-------------------------------------------------------
a-vr--------as---fl-klm--rlslprattapqspsnsilrlvtyyvrlqqrqqnrnrtwfiqswrlhnlqlglsa
-sl-ygrqqqhr--qwr--qtmlnlpvpgvtyssmrkrvqmiakaalreid m ghecindwvvwqlvlwperwgrngee
lr-qqemk  cms plqvshngimglkkanssrqilemepa                     lrll l gdrq e  aa 
earll e     p kghrrf     igf gpmqgeeah c                       a     f qh a     
   ec         a dgfc      ae fn ga                                      a       
                           a    f                                               

        
....:...
        
--------
pvqgarsr
nsnc gpf
 rc     
        
        
        
© 1998-2021Legal notice