Dataset for protein classical BH3-containing proteins of organism Suricata suricatta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------makqpsdvssecdreggqlqpaerppqlrpgaptslqt
cfqgkvrtfvtvpgsrpardlglmyssagaaracpwkvgasl---vtrqiceptstasppsptlrssvp-----------
                       hspl  rg daremgqiqevprmeernyrtspsprtavasvfp---sahht avtsv
                                    afphp feps qpkrgkrnqllatrrhtdletfaqeag slagr
                                            gc gkdafgqghga lpldg g  e ha   eg dk
                                                ea   naa    e    a             g
                                                     m                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qrq-----------------------------------------------------------------------------
---tnpglegdrcpqpspqgplapprwtlaaspgpfatrsrlfifvrrssllsrsssgyfsfdtdrspapmscdkstqtp
pqvgplegyysagtsggsvasssvs     trlpivtrerpvswm tqvgrwpqpglyssantysqyqlrtplshlqlfe
hpsqgdveqpgppirsvrpsdegsr     rlaaftgd mehrpg p q e  gma lll  lfnstg gcee eg ee 
 grpda allef  eqnqn  ddrh     mg  aie                           a    d          
  p a   f        d    cga     g                                                 
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------asmrqsqaapad-------------------------------------------------mrpei
sppcqainhylsam------t-sapspsqgvmlpcgvteepqrlfygnagyrlplpasfpaglplgeqppeghwql-a--
lts cgpglrptsqpvrgtq-s----                                                 -f-tv
e h           gllasprqglgn                                                 icgnm
              efk rlml   g                                                 h eal
               da gald                                                     f c e
                  d                                                             
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--w---iaqeLrrigdefnayy---prr--g-----ll------------------------------------------
rv-are-grq---ma-------mqq---kr-nvasq--ssptvsynrlvtyyvrlrgrgcpnmwtvfiqswrlhnlqlgl
qqr   y--- qn--sqlqrlhkglhqqgsnvtywtrprrwsmlillimrllplpqa eaiedrprlllvlwperwgrng
e     sfmt  crv k hgsf   fnpvqmrswtsmrqpvraiakaalgeid          eln     gdrq e  a
      c lk    s d        e arllpqqrlifkhgq                       a     f qh a   
        a                   nfelpmqkeea  c                                a     
                            leagnlfha                                           
                             a eliaa                                            
                                a                                               

       330
....:....|
          
----------
sapvqgarsr
eensnc gpf
a  rc     
          
          
          
          
          
© 1998-2020Legal notice