Dataset for protein classical BH3-containing proteins of organism Suricata suricatta

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=197 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQR
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=88 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQASMRQSQAAPADMRPEIWIAQELRRIGDEFNAYYPRRLA
GVPASSIL
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A673SRF7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Suricata suricatta GN=BCL2L11 (length=170 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTQRQDRSPAPMSCDKSTQTPSPPCQAINHYLSAMASMRQSQAA
PADMRPEIWIAQELRRIGDEFNAYYPRRGEGPSMFTEPKRVCASAKAAVTEYDRLQGRECINDRTAFIQSWRPEAWELGL
AAPVCCARSF
>gnl|bcl2dbpro|A0A673TA87_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Suricata suricatta GN=BMF (length=293 residues).
CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQLFAGCPERAYFGNNTARATVASTRASPPAAAAAPASASR
HPPQPAGLFPSFPIESGRQAPECSSRWTLARSPGITTRRRRLSPGVTQQGRWSQPGSLLSANLFAQSQLDCPLSHLQLFP
LTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEV
QIARKLQCIADQFHRLHMQQHQQNRNRVWWQLLLFLHNLALNAEENRNGAGPR
>gnl|bcl2dbpro|A0A673UI19_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Suricata suricatta GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPAEPEVECAMQLRRIGDKLNFRQKLMNLIAKLFRSGT
>gnl|bcl2dbpro|A0A673UKJ9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Suricata suricatta GN=BBC3 (length=130 residues).
MYSSAGAARACPWKVGASLVPRVPRQICGPQPSLSPAEPHLESPVPSAPGALAGGPTQAAPGIRGEEEQWAREIGAQLRR
MADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGAPEMEPN
>gnl|bcl2dbpro|A0A673UKJ9_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Suricata suricatta GN=BBC3 (length=100 residues).
MYSSAGAARACPWKVGASLVPRVPRQICETRGAAATPPLTLEGPVQSHHGTPALTQGPRSPGDGAQLGACTRPVDVGDLG
GRTLPPPDALASAGDFFCTM
>gnl|bcl2dbpro|A0A673V4V4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Suricata suricatta GN=BIK (length=156 residues).
MTEPNREEMSHAGPLSRDVFLSTFLQEHGPEVLDVPGVTDLVEYYDPGPSPNSNSPDDVAMRLAFIGDEMEVRWMVPRVG
ELPGMALYSLAFTYNQTGLRGVLRSLMDGLASLRENIRVWSFLTLRNRVSPNAGRGLALSLLLLVLLLSWGLHHLQ
>gnl|bcl2dbpro|A0A673V6P8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Suricata suricatta GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSPTDRGLGPSPTGDRPSGLGKHQRTAPGLLGEAGPQQGQPASSSRHGGAGAVETRSRHSSYPAGT
EEDEGTEEEEPSPFRGRSRSAPPNLCAALRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRFIQSWWDRNLG
RGGSAPSQ
© 1998-2020Legal notice