Dataset for protein classical BH3-containing proteins of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673UI19_PMAIP1-      ---------------------------------------------MPGKK
A0A673TA87_BMF-01       CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQLFAGCPERA
A0A673UKJ9_BBC3-01      -----------------------MYSSAGAARACPWKVGASLVPRVPRQI
A0A673UKJ9_BBC3-02      -----------------------MYSSAGAARACPWKVGASLVPRVPRQI
A0A673V4V4_BIK-01       ---------------------------------------------MTEPN
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673V6P8_BAD-01       ------------------------------------MFQIPEFEPSEQED
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A673UI19_PMAIP1-      ARKSAQPSPARAPAEPEVE-------------------------------
A0A673TA87_BMF-01       YFGNNTARATVASTRASPPAAAAAPASASRHPPQPAGLFPSFPIESGRQA
A0A673UKJ9_BBC3-01      CGPQPSLSPAEPHLESPVPSAPG---------------------------
A0A673UKJ9_BBC3-02      CETRGAAATPPLTLEGPVQSHHGTPALTQGPRSPGDGAQLGACTRPVDVG
A0A673V4V4_BIK-01       REEMSHAGPLSRDVFLSTFLQEHGPEVLDVPGVTDLVEYYDPGPSPNSNS
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ-----------------
A0A673V6P8_BAD-01       SSPTDRGLGPSPTGDR--------PSGLGKHQRTAPGLLGEAGPQQGQPA
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ-----------------
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQG
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQG
                                                                          

A0A673UI19_PMAIP1-      --------------------------------------------------
A0A673TA87_BMF-01       PECSSRWTLARSPGITTRRRRLSPGVTQQGRWSQPGSLLSANLFAQSQLD
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A673UKJ9_BBC3-02      DLGGR-----TLPPP-----------------------------------
A0A673V4V4_BIK-01       PDDVA-----MRLAFIGDEMEVRWMVPRVGELPGMALYSLAFTYNQTGLR
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A673V6P8_BAD-01       SSSRH-----GGAGAVETRSRH----------------------SSYPAG
A0A673SRF7_BCL2L11      --------------------------------------------DRSPAP
A0A673SRF7_BCL2L11      PLAPP-----ASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAP
A0A673SRF7_BCL2L11      PLAPP-----ASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAP
                                                                          

A0A673UI19_PMAIP1-      --------------------------------------------------
A0A673TA87_BMF-01       CPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEE
A0A673UKJ9_BBC3-01      ------------------------ALAGGPTQAAPG--------------
A0A673UKJ9_BBC3-02      ----------------------------DALASAGD--------------
A0A673V4V4_BIK-01       ------------------------GVLRSLMDGLAS--------------
A0A673SRF7_BCL2L11      ------------------------ASMRQSQAAPAD--------------
A0A673V6P8_BAD-01       TEEDEGTEEEEPS-----------PFRGRSRSAPPN--------------
A0A673SRF7_BCL2L11      MSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPAD--------------
A0A673SRF7_BCL2L11      MSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPAD--------------
A0A673SRF7_BCL2L11      MSCDKSTQTPSPPCQAINHYLSAMASMRQSQAAPAD--------------
                                                                          

A0A673UI19_PMAIP1-      ----------------------------------------------CAMQ
A0A673TA87_BMF-01       PQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQ-----IARK
A0A673UKJ9_BBC3-01      -----------------------------------IRGEEEQWAREIGAQ
A0A673UKJ9_BBC3-02      -----------------------------------FFCTM----------
A0A673V4V4_BIK-01       -----------------------------------LRENIRVW---SFLT
A0A673SRF7_BCL2L11      -----------------------------------MRPEI--W---IAQE
A0A673V6P8_BAD-01       -----------------------------------LCAAL--R---YGRE
A0A673SRF7_BCL2L11      -----------------------------------MRPEI--W---IAQE
A0A673SRF7_BCL2L11      -----------------------------------MRPEI--W---IAQE
A0A673SRF7_BCL2L11      -----------------------------------MRPEI--W---IAQE
                                                                          

A0A673UI19_PMAIP1-      LRRIGDKLN------FRQKLMNLIAKLFRSGT------------------
A0A673TA87_BMF-01       LQCIADQFHRLHMQQHQQNRNRVWWQLL----------------------
A0A673UKJ9_BBC3-01      LRRMADDLNALY---ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRARGA
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A673V4V4_BIK-01       LRNRVS---------PNAGRGLALSLLL----------------------
A0A673SRF7_BCL2L11      LRRIGDEFNAYY---PRRLAGVPASSIL----------------------
A0A673V6P8_BAD-01       LRRMSDEFQGSFKGLPRPKSAGTATQMRQSPS------------------
A0A673SRF7_BCL2L11      LRRIGDEFNAYY---PRRGEGPSMFTEPKRVCASAKAAVTEYDRLQGREC
A0A673SRF7_BCL2L11      LRRIGDEFNAYY---PRRVFLNNYQAAEAHPQMIILRLLRYIVRL-----
A0A673SRF7_BCL2L11      LRRIGDEFNAYY---PR---------------------------------
                                                                          

A0A673UI19_PMAIP1-      ------------------------------
A0A673TA87_BMF-01       ----------LFLHNLALNAEENRNGAGPR
A0A673UKJ9_BBC3-01      PEMEPN------------------------
A0A673UKJ9_BBC3-02      ------------------------------
A0A673V4V4_BIK-01       ----LVLLLSWGLHHLQ-------------
A0A673SRF7_BCL2L11      ------------------------------
A0A673V6P8_BAD-01       ---WTRFIQSWWDRNLGRGGSAPSQ-----
A0A673SRF7_BCL2L11      INDRTAFIQSWRPEAWELGLAAPVCCARSF
A0A673SRF7_BCL2L11      ---------VWRLQR---------------
A0A673SRF7_BCL2L11      -----------RLEQ---------------
                                                      

© 1998-2020Legal notice