Dataset for protein classical BH3-containing proteins of organism Suricata suricatta

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673UI19_PMAIP1-      -------------------------------------------------M
A0A673TA87_BMF-01       CFQGKVRTFVTVPGSRPARDLGLHSPLAGRGRDAREAGPHQLFAGCPERA
A0A673UKJ9_BBC3-02      -----------------------MYSSAGAARACPWKVGASLVPRVPRQI
A0A673UKJ9_BBC3-01      -----------------------MYSSAGAARACPWKVGASLVPRVPRQI
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673V4V4_BIK-01       ---------------------------------------------MTEPN
A0A673V6P8_BAD-01       ------------------------------------MFQIPEFEPSEQED
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
A0A673SRF7_BCL2L11      ------------------------------------------MAKQPSDV
                                                                          

A0A673UI19_PMAIP1-      PGKKARKSAQPSPARAPA--------------------------------
A0A673TA87_BMF-01       YFGNNTARATVASTRASPPAAAAAPASASRHPPQPAGLF---PSFPIESG
A0A673UKJ9_BBC3-02      CETRGAAATPPLTLEGPVQSHHGTPALTQGPRSPGDGAQLGACTRPVDVG
A0A673UKJ9_BBC3-01      CGPQPSLSPAEPHLESPVPSAPG--ALAGGPTQAAPGIRGEEEQWAREIG
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ-----------------
A0A673V4V4_BIK-01       REEMSHAGPLSRDVFLSTFLQEHGPEVLDVPGVTDLVEYYDPGPSPNSNS
A0A673V6P8_BAD-01       SSPTDRGLGPSPTGDR--------PSGLGKHQRTAPGLLGEAGPQQGQPA
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQ-----------------
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQG
A0A673SRF7_BCL2L11      SSECDREGGQLQPAERPPQLRPGAPTSLQTQRQGNPEGEGDRCPQGSPQG
                                                                          

A0A673UI19_PMAIP1-      --------------------------------------------------
A0A673TA87_BMF-01       RQAPECSSRWTLARSPGITTRRRRLSPGVTQQGRWSQPGSLLSANLFAQS
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      --------------------------------------------------
A0A673SRF7_BCL2L11      --------------------------------------------------
A0A673V4V4_BIK-01       PDDVAMRLAFIGDEMEVRWMVPRVGELPGMALYSLAFTYNQTGLRGVLRS
A0A673V6P8_BAD-01       SSSRHGGAGAVETRSRH----------------------SSYPAGTEEDE
A0A673SRF7_BCL2L11      ---------------------------------------DRSPAPMSCDK
A0A673SRF7_BCL2L11      PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
A0A673SRF7_BCL2L11      PLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDK
                                                                          

A0A673UI19_PMAIP1-      --------------------------------------------------
A0A673TA87_BMF-01       QLDCPLSHLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGV
A0A673UKJ9_BBC3-02      -------------------DLGGRTLPPPDAL------------------
A0A673UKJ9_BBC3-01      -------------------AQLRRMADDLNAL------------------
A0A673SRF7_BCL2L11      -------------------ASMRQSQAAPADM------------------
A0A673V4V4_BIK-01       LMDGLASLRENIRVWSFLTLRNRVSPNAGRGL------------------
A0A673V6P8_BAD-01       GTEEEEPS-----------PFRGRSRSAPPNL------------------
A0A673SRF7_BCL2L11      STQTPSPPCQAINHYLSAMASMRQSQAAPADM------------------
A0A673SRF7_BCL2L11      STQTPSPPCQAINHYLSAMASMRQSQAAPADM------------------
A0A673SRF7_BCL2L11      STQTPSPPCQAINHYLSAMASMRQSQAAPADM------------------
                                                                          

A0A673UI19_PMAIP1-      ---------------------------------------EPEVECAMQLR
A0A673TA87_BMF-01       TEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGHWQHRAEVQIARKLQ
A0A673UKJ9_BBC3-02      --------------------------------------------------
A0A673UKJ9_BBC3-01      ---------------------------------------YERRRQEEQQR
A0A673SRF7_BCL2L11      ---------------------------------------RPEIWIAQELR
A0A673V4V4_BIK-01       ---------------------------------------ALSLLL-----
A0A673V6P8_BAD-01       ---------------------------------------CAALRYGRELR
A0A673SRF7_BCL2L11      ---------------------------------------RPEIWIAQELR
A0A673SRF7_BCL2L11      ---------------------------------------RPEIWIAQELR
A0A673SRF7_BCL2L11      ---------------------------------------RPEIWIAQELR
                                                                          

A0A673UI19_PMAIP1-      RIGDKLNFRQKLMNLIAKLFRSGT--------------------------
A0A673TA87_BMF-01       CIADQFHRLH--------------------------------MQQHQQNR
A0A673UKJ9_BBC3-02      --ASAGDFFCTM--------------------------------------
A0A673UKJ9_BBC3-01      HRPSPWRVLYNLIMGLLPLPRARGAPEMEPN-------------------
A0A673SRF7_BCL2L11      RIGDEFNAYY---PRRLAGVPASSIL------------------------
A0A673V4V4_BIK-01       --------------------------------------------------
A0A673V6P8_BAD-01       RMSDEFQGSFKGLPRPKSAGTATQMRQSPS--------------------
A0A673SRF7_BCL2L11      RIGDEFNAYY---PRRGEGPSMFTEPKRVCASAKAAVTEYDRLQGRECIN
A0A673SRF7_BCL2L11      RIGDEFNAYY---PR-----------------------------------
A0A673SRF7_BCL2L11      RIGDEFNAYY---PRRVFLNNYQAAEAHPQMIILRLLRYIVRL-------
                                                                          

A0A673UI19_PMAIP1-      ----------------------------
A0A673TA87_BMF-01       NRVWWQLLLFLHNLALNAEENRNGAGPR
A0A673UKJ9_BBC3-02      ----------------------------
A0A673UKJ9_BBC3-01      ----------------------------
A0A673SRF7_BCL2L11      ----------------------------
A0A673V4V4_BIK-01       --LVLLLSWGLHHLQ-------------
A0A673V6P8_BAD-01       -WTRFIQSWWDRNLGRGGSAPSQ-----
A0A673SRF7_BCL2L11      DRTAFIQSWRPEAWELGLAAPVCCARSF
A0A673SRF7_BCL2L11      ---------RLEQ---------------
A0A673SRF7_BCL2L11      -------VWRLQR---------------
                                                    

© 1998-2021Legal notice