Dataset for protein classical BH3-containing proteins of organism Strigops habroptila

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                *   .                     . : .  ..   *        .
mdrpsyleedyssmdkqppe-khsr-gglgeq cpmtatgiftqnqsyqlrlprfplfalthcpgpairh pgqdkqtqt
             laglddd faqd fdga     aa           g l  a aaa g a ca p  ea  aapg 

        90       100       110       120       130       140       150       160
 .. .        . :   .    :   . .   . :.        . *      . :                    :.
fptrpssqivvrrcgvtgessrlfysgdavqlpiprvsfdkdrhppse pggqrhclaeppsr-qsrsraedlqpeiwfg
ap plfdfmlp   lec  pgc gfa e ah     cagapglg   cealgea   maal aapr            

       170       180       190       200       210       220       230       240
.:*. :.*:*:     ..               ..:  .  *                                      
qk qcmg q nrsymqqq-tvtpvl-sslhpvsqqnrnqsl kafppprprpaatppltapprvppprlnggvp-nrt-q
 e    a   halhcp h gflfra iaggagg n g   f                lhnlafgaegn fhg g

© 1998-2021Legal notice