Dataset for protein classical BH3-containing proteins of organism Strigops habroptila

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                *   .                     . : .  ..   *        .
--------------------v----d---mggPgevv-----------scspgvpqslpmspatptggvpPrqpprsvrp
mdrpsyleedyssmdkqppe-khsr-gglgeq cpmtatgiftqnqsyqlrlprfplfalthcpgpairh pgqdkqtqt
             laglddd faqd fdga     aa           g l  a aaa g a ca p  ea  aapg 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .. .        . :   .    :   . .   . :.        . *      . :                    :.
lspss--------splwsrprspyfvnggyrsr-aplgseletqtqepPqqvrsrsrsavq--w--------------ia
fptrpssqivvrrcgvtgessrlfysgdavqlpiprvsfdkdrhppse pggqrhclaeppsr-qsrsraedlqpeiwfg
ap plfdfmlp   lec  pgc gfa e ah     cagapglg   cealgea   maal aapr            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.:*. :.*:*:     ..               ..:  .  *                                      
rqLrrisDeFq-----rrv------s-------wrevlrvwWqlplr---------------------------r---g-
qk qcmg q nrsymqqq-tvtpvl-sslhpvsqqnrnqsl kafppprprpaatppltapprvppprlnggvp-nrt-q
 e    a   halhcp h gflfra iaggagg n g   f                lhnlafgaegn fhg g

 
.
 
-
r
q
© 1998-2020Legal notice