Dataset for protein classical BH3-containing proteins of organism Strigops habroptila

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A672TST9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Strigops habroptila GN=BCL2L11 (length=182 residues).
MAKQPPEVKAQRDGDGGEGPGPAAQLRPGAPAALPGSAATATAGPPPRGPPASPGPFATRSPLFIFVRRSPLLSRSSSGY
FSFDAERSPAPLSCDKATQTPSPPCQALSHCLSAMASRWQSPSRAEDLQPEIWIAQELRRIGDEFNASYCPRRVTFTFVL
SISLHPVSKREKLNHLWKLPLR
>gnl|bcl2dbpro|A0A672V891_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Strigops habroptila GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGIRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHIPPVGFALDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHMQR
HQQNRNQVWWQLFLFLHNLALNAEVNRNHTGQR
>gnl|bcl2dbpro|A0A672V9F8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Strigops habroptila GN=BAD (length=177 residues).
MGGPCEVVGCSPPVPPSAAMSPAPPAGGVPPPAPPRQVRPAPPPPSPLWGCPRPPCFVGGGVQARARLGSEGERGPGEPP
PGVRGRSRSAPPALWAARRFGRQLRRMSDEFQQQVGVLPRASSAGGAGGWREVLRSWWGAPPPPRPRPAATPPLTAPPRV
PPPRFGGGGPRFRGGGQ
© 1998-2020Legal notice