Dataset for protein classical BH3-containing proteins of organism Strigops habroptila

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672V891_BMF-01       MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A672TST9_BCL2L11      -------------MAKQPPEVKAQRDGDGGEGPGPAA-----------QL
A0A672V9F8_BAD-01       -----------------------------MGGPCEVV-----------GC
                                                        *   .             

A0A672V891_BMF-01       LLGRFQLFPLTHCCGPGIRHPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A672TST9_BCL2L11      RPGAPAALPGSAATATAGPPPRGPPASPGPFATRSPLFIFVRRSPLLSRS
A0A672V9F8_BAD-01       SPPVPPSAAMSPAPPAGGVPPPAPPRQVRPAPPPP--------SPLWGCP
                                . : .  ..   *        . .. .        . :   .

A0A672V891_BMF-01       RRLFYGNAGYRLHIPPVGFALDPHLQEEPQEGQREARAEVQ---------
A0A672TST9_BCL2L11      SSGYFSFDAERSP-APLSCDKATQTPSPPCQALSHCLSAMASRWQSPSRA
A0A672V9F8_BAD-01       RPPCFVGGGVQAR-ARLGSEGERGPGEPPPGVRGRSRSAPPALWAARR--
                            :   . .   . :.        . *      . :            

A0A672V891_BMF-01       --------IARKLQCIADQFHRLHMQRH---------------QQNRNQV
A0A672TST9_BCL2L11      EDLQPEIWIAQELRRIGDEFNASYCPRRVTFTFVLSISLHPVSKREKLNH
A0A672V9F8_BAD-01       --------FGRQLRRMSDEFQ-----QQVGVLPRASSAGGAGGWREVLRS
                                :..:*. :.*:*:     ..               ..:  . 

A0A672V891_BMF-01       WWQLFLF----------------LHNLALNAEVNRNHTGQR
A0A672TST9_BCL2L11      LWKLPLR----------------------------------
A0A672V9F8_BAD-01       WWGAPPPPRPRPAATPPLTAPPRVPPPRFGGGGPRFRGGGQ
                         *                                       

© 1998-2020Legal notice