Dataset for protein classical BH3-containing proteins of organism Sphaeramia orbicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                   :        .   *.      :   *       :     .       :*    ..    . 
----------p----wrttf----csssgestPgltlptnqgrqP-----qgvs---yslsltrpqmRsifrgrrrlsg-
medeeddvve-dvksmkrkyreiktidrstqs sfdgepgnrml ptpsqiqiketprphfysnfgl mhgpahlesnse
        fa cphclaaa      ead  le  ea aeee  e dseqec  aaell d  glaef la a  f  f d

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :.  .  .   *:                                              *   .
-----v---ee-----qslpstppsqrPmta------p-l--------------------------wvsvsygqtLrrys
svvsq-tre-ylsyrsengmesltrpq frrrsktqt-s-taqvmihalertaeahgegaflthdvslekkveyq qlmg
pqrrn sed  fqmegddead ega  a dkasap a                            aaaci  k geia

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
:::         .  *. .                                     
defvrvl----mrtvRsqg-----h--klww-------------------------
eqlhslhlqlylkrr qhstgrqm-sspt--sylfslqsmlgershienrknrtqr
   d e dkgeh nq na eankl hc    rlaaahlelefdngfhaghggage 
© 1998-2020Legal notice