Dataset for protein classical BH3-containing proteins of organism Sphaeramia orbicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673C8N3_BMF-01       MEDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGLALAPNNGMLP-----
A0A672YF93_BAD-01       ---------------MAAKF----TISDSESEPSEDLEEEQRRQPPTEQE
A0A673CKA1_BCL2L11      --------VAPCVKSLKRAY----CSASGELSPGFTGPTGEGREPDSPSQ
                                           :        .   *.      :   *     

A0A673C8N3_BMF-01       CGVAEEPRPLFYGNAGFRLHFPAHFELFGDPVRRQVSEEEE-----QNGM
A0A672YF93_BAD-01       QQIS---YSHSLTLPELRMAGAGRLRLNSESQVSNVTRDEELQMRGEDEA
A0A673CKA1_BCL2L11      IGVKATLLSDSLSRFQMRSIFRGRRRSSG-----------YFSYESDSLP
                          :     .       :*    ..    .                 :.  

A0A673C8N3_BMF-01       EQLPRQQPMAR-----------------------------------SVEA
A0A672YF93_BAD-01       STPTEGAPFRARSKSAPPAL--------------------------WAAK
A0A673CKA1_BCL2L11      DSPPSPRPMTADKATQTPSLTAQVMIHALERTAEAHGEGAFLTHDVWLSV
                        .  .   *:                                         

A0A673C8N3_BMF-01       CIGQKLQLIGDQFHREHLQLYHRNQRNQG--------PLWWRLAAALLSL
A0A672YF93_BAD-01       KYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKTWWSYLFSHQEM
A0A673CKA1_BCL2L11      SVEYTLGEYAEELVRVL----LRTRRQHSEGNKLHSCKL-----------
                             *   .:::         .  *. .                     

A0A673C8N3_BMF-01       LFDRGFIAGRGGAGQR
A0A672YF93_BAD-01       EGENSHHENHKNRTE-
A0A673CKA1_BCL2L11      ----------------
                                        

© 1998-2020Legal notice