Dataset for protein classical BH3-containing proteins of organism Sphaeramia orbicularis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A672YF93_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sphaeramia orbicularis GN=BAD (length=167 residues).
MAAKFTISDSESEPSEDLEEEQRRQPPTEQEQQISYSHSLTLPELRMAGAGRLRLNSESQVSNVTRDEELQMRGEDEAST
PTEGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKTWWSYLFSHQEMEGENSHHE
NHKNRTE
>gnl|bcl2dbpro|A0A673C8N3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sphaeramia orbicularis GN=BMF (length=163 residues).
MEDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGLALAPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELFGDPVRRQ
VSEEEEQNGMEQLPRQQPMARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAALLSLLFDRGFIAGRGGA
GQR
>gnl|bcl2dbpro|A0A673CKA1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sphaeramia orbicularis GN=BCL2L11 (length=162 residues).
VAPCVKSLKRAYCSASGELSPGFTGPTGEGREPDSPSQIGVKATLLSDSLSRFQMRSIFRGRRRSSGYFSYESDSLPDSP
PSPRPMTADKATQTPSLTAQVMIHALERTAEAHGEGAFLTHDVWLSVSVEYTLGEYAEELVRVLLRTRRQHSEGNKLHSC
KL
© 1998-2020Legal notice