Dataset for protein classical BH3-containing proteins of organism Sparus aurata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                   : . .   * .  .          :.   
mqhpsrppnssdgstavtagqgsggdpspagaagasaqtsrsdtgtvs-smqpspdegg egpps--ttktiikcdelqt
                                        maanfgip eg d e def      rgfre  a dg q

        90       100       110       120       130       140       150       160
      : *                        *     .       .:    .     : *  .               
qsqgpifh prrassgyfsyn-msppsvpls-- elvgngritpnppgqfmqhgrqvelqe rpgsgqlpsgmeqlsstr
fqp h  a           sd dllcgsaee    frda gf  hfea ael aldrda    e ea ehgdgapfrgrp

       170       180       190       200       210       220       230       240
   . .       *.:*. :.*:*              *   .     : ::              :     : *  .  
pqnapglsqeecy qk qlms e hsq-llrgvdk-qr ihkqlnqpnhmnhgrlmlrlvgl-lnyigriqfle gnghh
kpa a dma aa   e      d drl      ag em e inaghlk i  e a  lcgaa il   dhieia egdag

© 1998-2021Legal notice