Dataset for protein classical BH3-containing proteins of organism Sparus aurata

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671W556_BCL2L11      MQHPSRPPNSSDGSTAVTAGQGSGGDPSPAGAAGASAQTSRSDTGGVPSS
A0A671TL42_BAD-01       ----------------------------------------MAANFTISSE
A0A671X848_BMF-01       --------------------------------------------------
                                                                          

A0A671W556_BCL2L11      GQPSTSGGGEPDSPCWRRGKTISPLDSLGVFQTRSIFHLPRRASSGYFSS
A0A671TL42_BAD-01       SDSEPSEEVEEGEHS------QSPAEEGQQVSQRHALTL-----------
A0A671X848_BMF-01       MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALAL----------Y
                         : . .   * .  .          :.         : *           

A0A671W556_BCL2L11      DGDSLPSSPLSPRPLTVDRATQTPSPTGQVMQHALQRMAEERGPGTHQLH
A0A671TL42_BAD-01       -------------PELRMAGRIRLNSESHASTVSRDVELQARGEDEAGTP
A0A671X848_BMF-01       NGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVG---DQEARRQDSGGEQ
                                     *     .       .:    .     : *  .     

A0A671W556_BCL2L11      GHSPSPSSTRPQNAAGDMQAEAIGRELRRIGDDFNRQLLLRGVAGGQRRI
A0A671TL42_BAD-01       TDGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLL-----DKGEMRK
A0A671X848_BMF-01       SGMEQL---PRPQPVARSVEACIGQKLQLIGDQFH-------------RE
                                     . .       *.:*. :.*:*              * 

A0A671W556_BCL2L11      VINPNQLPHIHQEPAMLLCVGLLLLLIGRIIYLQGSTDSQDHSQV---
A0A671TL42_BAD-01       VKSAGTPKQMHHSRSWW-------SYLFSHQEMEGENNHHDNHTHRTE
A0A671X848_BMF-01       HLQLYHRNQRNQGPLWWRLGAALINLLFDRRFIAGGGGAGRR------
                          .     : ::              :     : *  .   .      

© 1998-2020Legal notice