Dataset for protein classical BH3-containing proteins of organism Sparus aurata

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A671TL42_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sparus aurata GN=BAD (length=166 residues).
MAANFTISSESDSEPSEEVEEGEHSQSPAEEGQQVSQRHALTLPELRMAGRIRLNSESHASTVSRDVELQARGEDEAGTP
TDGAPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMRKVKSAGTPKQMHHSRSWWSYLFSHQEMEGENNHHDN
HTHRTE
>gnl|bcl2dbpro|A0A671W556_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sparus aurata GN=BCL2L11 (length=245 residues).
MQHPSRPPNSSDGSTAVTAGQGSGGDPSPAGAAGASAQTSRSDTGGVPSSGQPSTSGGGEPDSPCWRRGKTISPLDSLGV
FQTRSIFHLPRRASSGYFSSDGDSLPSSPLSPRPLTVDRATQTPSPTGQVMQHALQRMAEERGPGTHQLHGHSPSPSSTR
PQNAAGDMQAEAIGRELRRIGDDFNRQLLLRGVAGGQRRIVINPNQLPHIHQEPAMLLCVGLLLLLIGRIIYLQGSTDSQ
DHSQV
>gnl|bcl2dbpro|A0A671X848_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sparus aurata GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALALYNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEARR
QDSGGEQSGMEQLPRPQPVARSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLGAALINLLFDRRFIAGGGGA
GRR
© 1998-2020Legal notice