Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mktyrsvgpmqlvsvlsisrrirscsaavsalaifhnlattvyahdallrtqrppererkrergkilelllpcsvsctvc
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------a--hsisddsstlrtgkkmsestq
elevncscaatphntgacqdssrnpnstslsqtpetqptsktsrrtpgpsrvvrmm-qmfghq-nedptngsidgrnehi
                     mdmeereqepkhldnplrrrsvgnsdtgrgnrlsdntl----y---vwedkevcesasr
                       daddai khcca gian g eera dgaelgqtkrr prpser ertkrtsrwp rl
                                                      iehnd mqfe g dq a lqlnd gd
                                                         f  dde  d       a    d 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .                     *          .                     :    
vrspq-sqtqtrp-lspsgrlrvyslsvprsvsmwqesepqdGatdeewlaegd---------pfrprsrsappalwpek
sknnsghrdfss-n-avqdyfsleqegrvynplrpnidllet qnalvngvtpsrsrppdvglhqhgqmqapvgvmgkam
ttqgm tsqkrnqpihspamvkgdvdvqhstlpynd-a-a-- nap gdsggr        v ------a---asv-a t
nqmkp gepgplhlf gn g psrfpalferf d--q-v-   gsg llfdp           r nv  -d avgis- i
knia  f eagkah        ch h e  p   st nae    l   ke                l  m   e   v  
gdh   c      d                m                                   a             

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  ..:*. :.*:*                                                       :           
kygrqLrrmsDeFdt--------------------------lldkg--rvksagsqlqmyrehgwfsflwslkesvvrf-
avaqk qlig q nrehlqlvilisdetsffssslwfslqwwycq-akeggrnnttrrtqq--siimwmndhigregqsr
qi  e  e     yq                          ----cmga--n--a-k-apnsparvaliytsvfedceef
           qi                          f sr  m-ss-vi-m-h---lsmmlti fgpp lyavvv
                                                t    a     rm    dd    k       c
                                                                       f        

      
....:.
      
--r---
pr-rvs
laet  
vvkn  
fg    
      
© 1998-2020Legal notice