Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A673HDR4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BMF (length=129 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGRPPLSPSGMLPCRVHVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQEHMMVTLLYTKVFSVCRVCFGRTVS
>gnl|bcl2dbpro|A0A673HRQ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A673I6H5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=147 residues).
MDKRLHGHQYDSSTLNDKKKGREETINTHGQHQDQTSPNISPQGRVRLYSESQVYMVSRWQEAVPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKEEEGRE
>gnl|bcl2dbpro|A0A673IWZ7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L11 (length=182 residues).
MADSTILKQTLANGPASRGSGESAGGGAVLRSEHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDS
VPSSPLMPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNE
HAIIMWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A673J5Q9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALAEENGGTGDG
LPFRGRSQSAPAVLWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A673J9C6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=288 residues).
MKTYRSVGPMQLVSVLSISRRIRSCSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRERGKILELLLPCSVSCTVC
ELEVNCSCAATPHNTGACQDSSRNPNRASESKHPDTQITRKTVRRTPTDSRNRLIMAQMFSISDNESDTETSEDCEDSDL
TKNNSGSQQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPFRPRSRSAPPALWAAKKYGRQLRRM
SDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A673JJ10_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BMF (length=203 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQTARTVLNSARDGDMAPFQEGPRALFHGNAGFR
SHFPALFEPVPDSTQNAEEDGGTPEEKEDERDVGISVEIQIGRKLREMGDQFQQEHLQLVILISDETSFFSSSLWFSLQW
FLSRCAMTSSSVISMLHMQMLSGRDDIIFGLPELYCVFVVVKN
>gnl|bcl2dbpro|A0A673NIJ7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L11 (length=138 residues).
PLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDGQNDEVWFAEPSHQHAQMAAPVGAMGPEM
AVARELRRIGDEFNRLYCQGAGAGGNNGAQLRAPNEHAIIMWMNDFIGRVVQFFLRRR
© 1998-2020Legal notice