Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673J9C6_BAD-01       MKTYRSVGPMQLVSVLSISRRIRSCSAAVSALAIFHNLATTVYAHDALLR
A0A673JJ10_BMF-01       --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
                                                                          

A0A673J9C6_BAD-01       TQRPPERERKRERGKILELLLPCSVSCTVCELEVNCSCAATPHNTGACQD
A0A673JJ10_BMF-01       --------------------------------------------------
A0A673HDR4_BMF-01       --------------------------------------------------
A0A673IWZ7_BCL2L11      --------------------------------------------------
A0A673NIJ7_BCL2L11      --------------------------------------------------
A0A673HRQ3_BAD-01       --------------------------------------------------
A0A673I6H5_BAD-01       --------------------------------------------------
A0A673J5Q9_BAD-01       --------------------------------------------------
                                                                          

A0A673J9C6_BAD-01       SSRNPNRASESKHPDTQITRKTVRRTPTDSRNRLIMAQMFSISDNESDTE
A0A673JJ10_BMF-01       -MDDEEDEQLPHCCETPLRNKSSENRDGPRGEVGQTANRHGRFEDRSTQT
A0A673HDR4_BMF-01       ----------------------------------------MDEDEDDVRR
A0A673IWZ7_BCL2L11      ---MADSTILKQTLANGPASRGSGESAGGGAVLRSEHFDFPQPSDGDPLR
A0A673NIJ7_BCL2L11      -----------------------------------------------PLR
A0A673HRQ3_BAD-01       -----------------------------------MAQMFSISDNESETE
A0A673I6H5_BAD-01       ----------------------------------MDKRLHGHQYDSSTLN
A0A673J5Q9_BAD-01       ----------------------------------MDNTLHDHQDDSSTWN
                                                                          

A0A673J9C6_BAD-01       TSEDCEDSDLTKNNSGSQQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLL
A0A673JJ10_BMF-01       ARTVLNSARDGDMAP-FQEGPRALFHGNAGFRSHFPALFEPVPDSTQNAE
A0A673HDR4_BMF-01       KGLQRWPSSRVQIKQ-TETAGRPPLSPSGMLPCRVHVEPRRFLY------
A0A673IWZ7_BCL2L11      GGIAMSNSHQSRSPM-SRTFSR---SSSGYFSVDSDSVPSSPLMPNISEA
A0A673NIJ7_BCL2L11      GGISMSNSHQSRSPM-CRTFSR---SSSGYFSVDSDSVPSSPLMPNISEA
A0A673HRQ3_BAD-01       TSEDCEESGQVKNNS-GSPQRKQHLAVPDRLKGEQLGRHRNLSMNDEDLL
A0A673I6H5_BAD-01       DKKKGREETINTHGQ-HQDQTSPNISPQGRVRLYSESQVYMVSRWQEAVP
A0A673J5Q9_BAD-01       DKKKGREETIKNQGQ-HQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEP
                                                      .                   

A0A673J9C6_BAD-01       ETGAADEGDLVGGD---------PFRPRSRSAPPALWAAKKYGRQLRRMS
A0A673JJ10_BMF-01       EDGGTPEEKEDERD-------------------VGISVEIQIGRKLREMG
A0A673HDR4_BMF-01       --GNTGLLLLAPPSRSRPPDVVLRQNLRMMDPAESV--ETLIGQKLQLIG
A0A673IWZ7_BCL2L11      QDGQNDEVWSAEPS---------HQHVQMAAPVGAMGPEMAVARELRRIG
A0A673NIJ7_BCL2L11      QDGQNDEVWFAEPS---------HQHAQMAAPVGAMGPEMAVARELRRIG
A0A673HRQ3_BAD-01       ETGAADEGDLVGGD---------PFRPRSRSAPPALWAAKKYGQQLRRMS
A0A673I6H5_BAD-01       QDGASAEENGGTGD-------GLPFRGRSQSAPAALWKAKKYGRQLRRMS
A0A673J5Q9_BAD-01       QDGALAEENGGTGD-------GLPFRGRSQSAPAVLWKAKKYGRQLRRMS
                          *          .                     :      ..:*. :.

A0A673J9C6_BAD-01       DEFDI--------------------------LLDKGMKRVKSAGTTRQMQ
A0A673JJ10_BMF-01       DQFQQEHLQLVILISDETSFFSSSLWFSLQWFLSRCAMTSSSVISMLHMQ
A0A673HDR4_BMF-01       DQFYQ---------------------------------------------
A0A673IWZ7_BCL2L11      DEFNR--------------------------LYCQGAGAGGNNAAQLRAP
A0A673NIJ7_BCL2L11      DEFNR--------------------------LYCQGAGAGGNNGAQLRAP
A0A673HRQ3_BAD-01       DEFDI--------------------------LLDKGMKRVKSAGTTRQMR
A0A673I6H5_BAD-01       DEFDT--------------------------WLDKG--EVKRANSQKQTY
A0A673J5Q9_BAD-01       DEFDT--------------------------WLDKG--EVKRANSQKQTY
                        *:*                                               

A0A673J9C6_BAD-01       QSPSWFAFLWSHKESDAESRPAE---
A0A673JJ10_BMF-01       MLSGRDDIIFGLPELYCVFVVVKN--
A0A673HDR4_BMF-01       -EHMMVTLLYTKVFSVCRVCFGRTVS
A0A673IWZ7_BCL2L11      NEHAIIMWMNDLIGRVVQFFLRRR--
A0A673NIJ7_BCL2L11      NEHAIIMWMNDFIGRVVQFFLRRR--
A0A673HRQ3_BAD-01       QSPSWLAFLWSHKESDAESRPAE---
A0A673I6H5_BAD-01       R--GWFSFLWSSKEEEGRE-------
A0A673J5Q9_BAD-01       R--GWFSFLWSPKEEEGRE-------
                                :                 

© 1998-2020Legal notice