Dataset for protein Bim of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                            ******:***********.*****************
--------------------------------------------PLRGGIsMSNSHQSRSPMsRTFSRSSSGYFSVDSDS
madstilkqtlangpasrgsgesagggavlrsehfdfpqpsdgd      a           c                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************** *******.****************************************.********
VPSSPLMPNISEAQDGQNDEVWsAEPSHQHvQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNgAQLRAPNE
                      f       a                                        a        

       170       180  
....:....|....:....|..
*********:************
HAIIMWMNDlIGRVVQFFLRRR
         f            
© 1998-2020Legal notice